Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8d1d-ps Olfactory Receptor

Gene Symbol Or8d1d-ps
Organism Rat
Family 8
Subfamily d
Pseudo Yes
Location chr8:42786859-42787782 (+)
Aliases Olr1272-ps, Olr1272-ps

Sequence information


Nucleotide sequence

ATGGGCACTGGGAATCATTCTGCAGCAGTTGTGTTCATCTTGGTGGGATTAACCCAGCAG
CCTGGGCTCCTGCTGCCCCTCTTCCTTCTGTTCCTGAGCATCTAAGTGGTGACAGCAGTG
GGGAATCTGGGCATGATCCTGCTCATCTCAGTCAGCCCACTTCTGCACACTCCCATGTAC
TATTTCCTCAGCAGTTTATCCTTTGTTGATCTCTGCTATTCCACTGCCATTACACCCAAA
ATGCTGGTGAACTTCCTTGGGAAGAAAAATATGATTGTCTATTCAGAGTGCATGGCCCAG
CTCTTTTTCTTTGTAATCTTTGTGGTGGCCGAGGGTTACCTCCTGACTGCCATGGCATAT
GATCGCTATGTGGCCATCTGCAGACCATTGCTCTATAATGTGATGATGTCCCCTAGACTC
TGCTCACTGCTAGTACTGGTTGCTTTCATCTTAGGCTTTATGTCAGCTTTAGCACACACA
AGTGCTATGATGAATCTGAGCTTCTGTAAATCGTACATCATAAGCCATTATTTCTGTGAT
GTTCTTCCCCTCCTAAACCTCTCCTGCTCTGACACAAAGCTGAATGAGCTTCTCCTATTT
ATCATTGCAGGCTTCAACACCTTGGTGCCTACACTAGCTGTTGCCATCTCCTATATCTTC
ATATTCTGCAGCATCATTCATATCAGCTCATCAGAGGGCAGGTCCAAAGCATTTGGAACC
TGCAGCTCTCATCTCATGGCTGTGGGGATCTTCTTTGGGTCTATCACCTTTATGTATTTT
AAGCCTCCTTCAAGTAACTCCCTGCAGCAAGAGAAGGTGTCTTCTGTGTTCTATACCACA
GTAATCCCCATGCTGAACCCATTAATATATAGTTTGAGGAACAAAGATGTGAAGAAATCA
TTGGCAAGATTCGTACTAAGGAGA


Conceptual translation

MGTGNHSAAVVFILVGLTQQPGLLLPLFLLFLSI*VVTAVGNLGMILLISVSPLLHTPMY
YFLSSLSFVDLCYSTAITPKMLVNFLGKKNMIVYSECMAQLFFFVIFVVAEGYLLTAMAY
DRYVAICRPLLYNVMMSPRLCSLLVLVAFILGFMSALAHTSAMMNLSFCKSYIISHYFCD
VLPLLNLSCSDTKLNELLLFIIAGFNTLVPTLAVAISYIFIFCSIIHISSSEGRSKAFGT
CSSHLMAVGIFFGSITFMYFKPPSSNSLQQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKS
LARFVLRR