Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8h10 Olfactory Receptor

Gene Symbol Or8h10
Organism Rat
Family 8
Subfamily h
Pseudo No
Location chr3:74411584-74412630 (+)
Aliases Olr526, Olr526

Sequence information


Nucleotide sequence

ATGTACATTTACATAAAAATCCTTTTCAAGTTAATCAAGCTGAGTATCACCTTTGATTTC
TCTTCAGTTTTAGGATTGTTAACTATGAACAACTGGAATTACACAAAAGAGTCCGACTTT
ATCCTCATGGGGCTGACAGATTCCAAAGAGTTACAGCTGGTCCTCGCTGTGCTGTTTCTG
CTGATATACCTGGTCACTGTGCTGGGAAACACAGGCATGATGCTGATCATCCGTCTAGAT
GCTCGGCTTCACACTCCAATGTATTTCTTCCTAACCCATCTGTCATTCCTTGACCTCTGT
TACTCAACTGTCATCACACCTAAGACTTTACAGAATCTGCTGACTTCCAACAAAATCATT
TCCTTTATTGGCTGTTTCACTCAGATGTATGGTTTTGTCCTCTTGGCTGCTGCTGAATGT
TTCCTTCTTGCTTCAATGTCCTATGACAGATATGTGGCTATCTGCAACCCTTTACACTAC
CCAGTTATCATGTCCACAAGGTTCTGCAGTGCCCTTCTCACTGGTTCCTATATGATTGGA
ACTTTGGACTCCACTATTAATATACTTTGTATGAACACCTTATATTTCTGCAGACCCAAG
GTTATCCATCATTTTTTTTGTGACACATCTCCAATTTTAATACTGTCTTGTAATGATACA
CATAACATTGAAATCATTATATTCATCTTTGCTGGTTCTACTCTAATGGTGTCTCTTATC
ACAATATCTGCATCCTATGTGTCCATTCTTTCTACTATTTTGAAGATCAATTCCACTTCA
GGAAAACACAAAGCCTTCTCCACTTGTGCCTCTCATCTCCTAGGAGTCACTGTGTTTTAT
AGTACTATGATTTTTACTTATTTGAAACCAAGTAATTCCTACTCCTTGGGAAAGGATCAA
GTGGCTTCTGTTTTTTATACTATTGTGATCCCCATGCTGAACCCACTTATTTATAGTCTC
AGAAACAAAGAAGTGAAAAATGCTGTTCATAGAGTTATCAAAAAGCAGGAAAACTCAAGG
CTTAAGTTCAGAGTGGCACTAAGTAAT


Conceptual translation

MYIYIKILFKLIKLSITFDFSSVLGLLTMNNWNYTKESDFILMGLTDSKELQLVLAVLFL
LIYLVTVLGNTGMMLIIRLDARLHTPMYFFLTHLSFLDLCYSTVITPKTLQNLLTSNKII
SFIGCFTQMYGFVLLAAAECFLLASMSYDRYVAICNPLHYPVIMSTRFCSALLTGSYMIG
TLDSTINILCMNTLYFCRPKVIHHFFCDTSPILILSCNDTHNIEIIIFIFAGSTLMVSLI
TISASYVSILSTILKINSTSGKHKAFSTCASHLLGVTVFYSTMIFTYLKPSNSYSLGKDQ
VASVFYTIVIPMLNPLIYSLRNKEVKNAVHRVIKKQENSRLKFRVALSN