Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or8w1 Olfactory Receptor

Gene Symbol Or8w1
Organism Rat
Family 8
Subfamily w
Pseudo No
Location chr3:75,719,400-75,720,300 (-)
Aliases Olr576

Sequence information


Nucleotide sequence

ATGAACATATACTTTTTAATTTTAAGGCTTATTAAAAAAATGGACAAGAAAAATTGTTCC
TCTGTGGGTGAATTCATCTTCTTGGGAATTACCAATAACCCTGACATGAAAGTGGCCCTC
TTCACCACACTCCTACTTGTTTATCTCATTAATCTTCTGGCCAATCTTGGGATGATCATC
TTAATTAGAGTAGACACTCAGCTGCAGACACCCATGTACTTTTTCCTCAGCCACCTCTCT
TTCTGTGACCTCTGCTATTCCACAGCAATTGGACCCAAGATGTTGGTGGACCTTTTAGCT
GAGGAGAAATCAATTCCCATTGTTGGTTGTGCTCTGCAGTTTTTTACGTTCTGTGTCTTT
GCAGATTCTGAGTGTCTACTGCTGGCAGTGATGGCCTATGATAGGTACCAGGCCATCAAT
AATCCATTGCTCTATACAGTGAACATGTCCAGCAGGCTGTGCTCCCTCCTGATGTCTGGG
GTTTACCTGGTGGGAACAGCAGATGCTTTGATACATACAACCCTGGCCTTCCGCTTGTGT
TTCTGCAGGTCTAATGAGATCAACCACTTTTTCTGTGATGTTCCTCCTCTTCTGTTAATA
TCTTGCTCAGATACAGAGGCCAATGAGTTAGCTATATTCACAATTTTTGGGTTTATTGAG
CTGAGCACCATTTCTGGAGTCCTTGTATCCTATAGCTACATCATATTATCAGTCTTGAAG
ATTTGCTCTGCTGAGGGGAGGTTTAAAGCTTTCTCCACCTGTGCTTCCCACCTGACTGCA
GTGGCAGTGTTCCAGGGGACTATGCTCTTTATGTATTTCCGGCCAAGTTCTTCCTATTCT
CTAGATCAAGACAAAATGACTTCACTCTTCTACACTCTGGTGATTCCAATGTTGAACCCT
CTGATTTACAGCCTGAGGAACAAAGATGTGAAAGAGGCTCTGGCAAAATTGAAGAATAAT
TGG


Conceptual translation

MNIYFLILRLIKKMDKKNCSSVGEFIFLGITNNPDMKVALFTTLLLVYLINLLANLGMII
LIRVDTQLQTPMYFFLSHLSFCDLCYSTAIGPKMLVDLLAEEKSIPIVGCALQFFTFCVF
ADSECLLLAVMAYDRYQAINNPLLYTVNMSSRLCSLLMSGVYLVGTADALIHTTLAFRLC
FCRSNEINHFFCDVPPLLLISCSDTEANELAIFTIFGFIELSTISGVLVSYSYIILSVLK
ICSAEGRFKAFSTCASHLTAVAVFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPMLNP
LIYSLRNKDVKEALAKLKNNW