Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9a4 Olfactory Receptor

Gene Symbol Or9a4
Organism Rat
Family 9
Subfamily a
Pseudo No
Location chr4:68,804,700-68,805,600 (+)
Aliases Olr799

Sequence information


Nucleotide sequence

ATGTTCGGGAATCACACTAGTGCTACTAAATTTTATCTTGTTGGCTTTCCTGGCTCTGAA
AAACTACACCACATCCTGTTTGCTACCTTCTGCTTCTTCTACTTAGTCACACTAGTGGGA
AACACAGTCATCATTGTGATTGTCTGTGTTGATAAACGTCTGCAGTCCCCCATGTATTTC
TTCCTTGTTCACCTCTCCATCCTGGAGATCTTGGTCACAACTGTTATTGTGCCGGTGATG
CTTTGGGGGCTGCTACTCCCTGGAATACAAGTTATATCTTTGGCTGGGTGTGTTGCCCAA
CTTTTTCTGCAACTTGCTCTGGGGACCACAGAGTTTTCTTTGCTTGGAGCTATGGCTGTG
GATCGTTATGTAGCTGTCTGCAACCCTTTGAGGTACAGTGTCATCATGAACAGTCGCACC
TGCAACTCTGTGGTAATCGTGTCTTGGGTATTTGGCTTCCTTTATCAAATCTGGCCGGTG
TATGCCACATTTCACCTTAACTACTGCAAATCAAATGTGTTGGACAATTTCTTCTGTGAC
CGAGGGCAGTTGCTCAAATTATCCTGCAATAATACTATTTTCATAGAGTTTATCCTCTTT
TTAATGGCAGTCTTTGTTCTTTTTGGTTCTTTGATCCCCACAATTGTGTCCTACACCTAT
ATCATTGCCACCATCCTCAAGATCCCCTCAGCCTCGGGCCGGAGGAAAGCCTTCTCCACC
TGTGCCTCCCACTTCACCTGCGTTGTCATTGGCTACGGCTGCTGCTTGTTCCTCTATGTG
AAACCCAAGCAGACCCAGGCAGCCGACTATAATAGGGTAGTTTCCTTGATGATTTCGATC
GTAACTCCTTTCCTCAACCCTTTCATCTTCACACTCCGTAATGACAAAGTCATAGAAGCC
CTTCGTGATGGAGTGAACCGTTGCTACCACTTATTCAAGAGC


Conceptual translation

MFGNHTSATKFYLVGFPGSEKLHHILFATFCFFYLVTLVGNTVIIVIVCVDKRLQSPMYF
FLVHLSILEILVTTVIVPVMLWGLLLPGIQVISLAGCVAQLFLQLALGTTEFSLLGAMAV
DRYVAVCNPLRYSVIMNSRTCNSVVIVSWVFGFLYQIWPVYATFHLNYCKSNVLDNFFCD
RGQLLKLSCNNTIFIEFILFLMAVFVLFGSLIPTIVSYTYIIATILKIPSASGRRKAFST
CASHFTCVVIGYGCCLFLYVKPKQTQAADYNRVVSLMISIVTPFLNPFIFTLRNDKVIEA
LRDGVNRCYHLFKS