Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or9i1-ps Olfactory Receptor

Gene Symbol Or9i1-ps
Organism Rat
Family 9
Subfamily i
Pseudo Yes
Location chr1:230,704,000-230,705,000 (+)
Aliases Olr381-ps

Sequence information


Conceptual translation

MAKNNVTTVTEFILMGFNDHPNWEIPLFLVFLSLYLVTILGNLGMIILIHIDVQLHIPMY
FFLSHLSVLDTCYTSVITPQILVTLATGKTAISYDSCAAQFFFFTVCAGTECFLLSVMAY
DRYVAISKPLLYTVAMHPRKCWSLVVEAYLCGVSGAILHTTFTFSLSFC\NNQINFFFC
DFPPLLKLACSNTANVESIVFFGNFVILANAFVILISYLLIIKAVMKMKFSGRRAKTFST
CVSHLTAVALLFGTLIFMYMRSGS/KSLEEDKVVSVFYTIVIPMLNPLIYSLRNKDVKS
AFKKVIGKCQV