Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR10AG46P Olfactory Receptor

Gene Symbol Modo-OR10AG46P
Organism Opossum
Family 10
Subfamily AG
Pseudo Yes
Location scaffold_19209:0-657,158 (+)

Sequence information


Nucleotide sequence

ATGAATCGAGGAAATCTGACTGATAAAGTGGACTTTTACCTCCTAGGATTTTCTGACCTT
CCTAACATCCAAGAATTTCTGTTTGGGATTTTTTGGTCATGTATAGAGTATTCTTATAGG
AAATGGTCTCATAATTTTAATTACTAAGACAGATATTTCCCTCCAAACCCCAATGTAGTA
TTTCCTTGGGAGTTTTTCTTTCTTGGAAATATTTATGCATCAGTCACTGTTCCAAGAATG
CTGATAGATCTATGGACTCACAATGACAATATATCTCTGTTGGCCCGTGCCTCACAACTT
TGTTTCTTTCTGATTTTTGGAATAACTGAATGCTTCCTTCTGGCAGTGATGGCATATGGC
TGCTATGTAGCCATTTGTAAGCCTCTGTACTATCTTGTCATCATGAGACAACAGTTGGGT
ATTTCACTTGTGATTGGATTGTGGATCACTGCCATCCCAGTTGTGATCATAGAAAATATC
AGATATTTTCTATGCCCTTTTGTGGACCTACTAAAATCAATCAGGTTTTCTGTGATGTTT
ATCCAGTACTGCAGGCGTCTTGTGGAGACACCTCTATGAGTGAGCTTTCTGTCTATGCTG
ATGTTGTGCTTTTTGCCATGATTCCCTTTATATTAATACTTAATTCTTACATCAAAATCA
TCACAACCATATTAAAGTTCCCCTCAACTATGGGAAGGTCCAAAGCATTCTCAACTTGCT
CCTCCCACCTTGTTGTTGTCAGTTTATTCTTTGTAACTGCAATCATGACACATTTGCAAA
CCAAGTCCAGCCATTGCATAGTCCCTGAGAGGGAGCTTTCTATTTTATATACCACTGTGA
CTCCACTGGTTAATCCCATGATTTATAGCCTGAGAAACAAAGATGTCATTTTGGTATTAA
GGAAATTATTAATTAAA


Conceptual translation

MNRGNLTDKVDFYLLGFSDLPNIQEFLFG/FLVMYRV/LIGNGLIILITKTDISLQTP
M*YFLGSFSFLEI/YASVTVPRMLIDLWTHNDNISLLARASQLCFFLIFGITECFLLAV
MAYGCYVAICKPLYYLVIMRQQLGISLVIGLWITAIPVVIIENI/IFSMPFCGPTKINQ
VFCDVYPVLQASCGDTSMSELSVYADVVLFAMIPFILILNSYIKIITTILKFPSTMGRSK
AFSTCSSHLVVVSLFFVTAIMTHLQTKSSHCIVPERELSILYTTVTPLVNPMIYSLRNKD
VILVLRKLLIK