Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR10AG47P Olfactory Receptor

Gene Symbol Modo-OR10AG47P
Organism Opossum
Family 10
Subfamily AG
Pseudo Yes
Location scaffold_19209:0-1,123,940 (+)

Sequence information


Nucleotide sequence

ATGGGATTTGTTCTGTTGGGTTTTCTAACCTTTCCAAACTCCAAGCATTTCTGTTTGTGA
TCTCCTTTGTTATAAACATGAGTATCCTGATAGGAAATGGTCTCATCACTGCTCTAACCA
AGGTAGGTCCCAGTCTCCAAACACCTATGAATTTTTTTCTTGGAAATTTTTCCTTTGTTG
AAATCTGTTATATATCAGTCACCCTCCCAAGGTTGCTGATGTACCTTCTGACACAAAACC
CATATATTTCTTTAGTTGCCTGTGCTTTTCAGCTTTGTTTATTTCTTATTCTTGTTGTAA
CAGAATGCTTACTTCTGACTGTGATGGGCATATGACTGCAACATGGTAATTTATTAACCC
CTGTACCATCCAGTCATCGTGGACAACAAAGTGTGTGTCCAGCTGATTGCTGGCCCCTCA
ATCACTGGAATTCCAGTGGTAATAGGACAGATCTATCAGATATTTTCCCTACCATTCTGT
GGTTCTAGCAAACTCAATCATATTTTCTGGGACATGCCCGCAGTAGTGAAGATGACCTGT
GGGAACATATTTGTAAATGAATTCTCAGTCCATGGTGATGCTGTACTATTTTCTTTGATT
TCCTTTCTCTAGTTACTTTGTTCCTATGTAAAAATCATCATGACACTCCTTAAACTGCCA
TCAACCACTGGGAGATACAAATTGTTTTCTACTTACTCTTCCCTCCTAATAGTTGTCATC
TTGTTTTTTGGGTCTGGTCTTACTGTGTATTTCAGATCCAAAACCAATCACTCAGAAGAA
GCAGACAGAGATTTTTTTCCTCTTTCTACATCATTGTGACATCAATGTTTAACCCTATGA
TATGCACATTAAGGAAGAAAGATGTCCTTGATGCTCTGAGAAAATTAACT


Conceptual translation

MGFVLLGFLTFP/LQAFLFVISFVINMSILIGNGLITALTKVGPSLQTPMNFFLGNFSF
VEICYISVTLPRLLMYLLTQNPYISLVACAFQLCLFLILVVTECLLLTVM\YDCNMVIY
*PLYHPVIVDNKVCVQLIAGPSITGIPVVIGQIYQIFSLPFCGSSKLNHIFWDMPAVVKM
TCGNIFVNEFSVHGDAVLFSLISFL*LLCSYVKIIMTLLKLPSTTGRYKLFSTYSSLLIV
VILFFGSGLTVYFRSKTNHSEEADRD/FSSFYIIVTSMFNPMICTLRKKDVLDALRKLT