Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR10AN1P Olfactory Receptor

Gene Symbol Modo-OR10AN1P
Organism Opossum
Family 10
Subfamily AN
Pseudo Yes
Location scaffold_19209:0-605,788 (+)

Sequence information


Nucleotide sequence

TGCTATGATTCAGTCATCCTTCCAAGAGTTCTATTTAATCTGTGAACCGAGAAGAACATG
TTTCTTTTGCCTCCTGGAAAATTCAATTTTGTTCTTTCTTTGTTATGACTATGATTGAAA
ATTGTCTCCTGACTTCAATGGACTGCCATTTGTTAGTGCCTGAATTAACCTCTTGTCATG
AAACACAAGGTATCTATGCATTTGATGGTTAGTTCTTAGGTAAGTGGGATGCCAAACCTT
ATATTGCTGGCTTACTTGATTTTTTCTTTACCTTTCTGTGGGTCGCAAAAACTTAATCAC
ATTTTTTGTGACATTCCCCCATTACTGAAGTTGGCCTGTGCATACAGCTCTATGGATGAT
TTCTTGTTTTATGATATTGTCTCGGTAGTTGCACAATTCTATTTATGTTAATAATATGGT
CATATATGACAATCGTCACAAATATTCTGAAGGTTCTAGGAACCAAGGGGAGAGTTAAAG
CCTTTACTACTTGTTCCTCTCATCTTATGGTTGTGGTGCTATACTTTGGATTAAGTATTT
CATATTTGCAACCTAGTTTTTGGCCACTTAGCAGGACTAGATAAAGTGTTCTCTATCTTT
TATTCCAATGGAACTGTAGTATTTAATCCCATCATACACAATTTGCACAGCAAAGATGTT
GTGGCATTAAAAAAATACTATCTAAGAGACTGTGATAAT


Conceptual translation

CYDSVILPRVLFNL*TEK/HVSFAS/ENSILFFLCY/L*LKIVS*LQWTAIC*CLN*
PLVMKHKVSMHLMVSS*VSGMPNLILLAYLIFSLPFCGSQKLNHIFCDIPPLLKLACAYS
SMDDFLFYDIVSVVAQFYLC/IIWSYMTIVTNILKVLGTKGRVKAFTTCSSHLMVVVLY
FGLSISYLQPSF\HLAGLDKVFSIFYSNGTVVFNPIIHNLHSKDVVALKKYYLRDCDN