Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR13T8 Olfactory Receptor

Gene Symbol Modo-OR13T8
Organism Opossum
Family 13
Subfamily T
Pseudo No
Location scaffold_19209:0-920,353 (+)

Sequence information


Nucleotide sequence

ATGGAAGAATTTATTCTCCTGGGCTTTTCTGAATATCCCAATGTCCAAAGATTTCTCTTT
GTTGTTTTTCTATTCATCTACATAAGTATCTTATTAGGTAATGGTCTCATCATTATAATC
ACCAATGTGGAATCATCTCTTCAAACACCTATGTATTACTTCCTTGGAAACGTCTCCTTT
GTGGAAATGTGTTACACATCAAACATCCTCCCCAGAATGCTTGTGAATATTTGGAGACAG
AGAAGGAGTATTTCTTTACTGTCATGTGCTGCACAGCTCTGTTTCTTTCTCATTCTAGGA
GTCACAGAGAGCTTCCTCCTGGCTGTGATGGCCTATGACCGCTATGTGGCCATTTCTAAG
CCACTCTACTATCCTATAATCATGAATCATAAGATGTGTATGAAAATGGTTGTGGACTCC
TGGGTCAGTGGGATTCCAGTCATGATCATGCAAACATACCATGTTTTTTCTGTGCCTTTT
TGTGGTTCTAACAAACTCAATCATATTTTCTGTGACATGCCCCCTTTAATTAAGTTGGCA
TGTGGAGACATCTCTGGGGGTGAATTCTTTCTTTTTGTTGATTGTTTCCTGTTTGGTTTG
ATTCCTTTTCTGATGATACTCATGTCTTACATTAGAATCCTTGGCACTATCCTGAAGCTC
TCATCTACCACTGGCATATCCAAAGCCTTCTCTACTTGTTCCTCTCATCTAATAGTTGTA
TGCTTATTCTATGGTTCTGGTTTAATTGCATATTTTCAATCTGAGTCCAGTTCTTCAGGC
AGCATAGAAAAGATCTTCTCTGTATTCTACACCATTGTGACACCAATGATTAATCCTATG
ATTTATAGTCTAAGGAATAAGGATTTTATTGCAGCAATGAAAAAATTATTTTCTAAATGG
AGAGGA


Conceptual translation

MEEFILLGFSEYPNVQRFLFVVFLFIYISILLGNGLIIIITNVESSLQTPMYYFLGNVSF
VEMCYTSNILPRMLVNIWRQRRSISLLSCAAQLCFFLILGVTESFLLAVMAYDRYVAISK
PLYYPIIMNHKMCMKMVVDSWVSGIPVMIMQTYHVFSVPFCGSNKLNHIFCDMPPLIKLA
CGDISGGEFFLFVDCFLFGLIPFLMILMSYIRILGTILKLSSTTGISKAFSTCSSHLIVV
CLFYGSGLIAYFQSESSSSGSIEKIFSVFYTIVTPMINPMIYSLRNKDFIAAMKKLFSKW
RG