Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR4A62 Olfactory Receptor

Gene Symbol Modo-OR4A62
Organism Opossum
Family 4
Subfamily A
Pseudo No
Location scaffold_19209:0-2,467,640 (-)

Sequence information


Nucleotide sequence

ATGGAAAACAAGAATAATGTAACTGAGTTCATCCTCCTGGGGCTTACCCAGAATTCTCAA
ATGCAAAAAGTATTATTTGTCATATTCTCAATTATGTACATTTTAACCATGGTGGGAAAT
ATTCTGATTATTATAACAATTACTGAAAGCAAGAGCTTGAATTCTCCCATGTACTTGTTT
CTTGCCTTTTTGTCTTTCATGGATGCTACCTATTCCACTATTATTGTCCCTAAAATGATC
CTAGACCTGCTCTATGAAAAGAAAACCATTTCTTTCCAAGCCTGCATGGTCCAGCTCTTC
TTGGAACATGTATTTGGTGGTGCTGAAGTTTTCCTCCTCGTGGTTATGGCCTATGATCGC
TATGTAGCTATCTGTAAACCATTGCATTACTTAATCATTATGAGATGGCGTGTATGTATT
ATACTCTTGGTGGTGTCCTGCATTAGTGGATTTATGCATTCTTTTATTCAGCTCCTTTTT
GTTTTTAGGCTTCCATTCTGTGGACCCAATGTAATTGATCATTTCGCATGTGACATTTAT
CCTTTATTGAAACTTTCCTGTACAAATACCTATATAATTGGCTTCTCAGTGGTTGCTAAT
GCAGGAGCGATATGCACAATTGTCTTTTTACTATTGCTTATCTCATATGGGGTCATTCTA
CACTCATTGAAGACTCAAAGTCTGGAAGGGCGACGAAAAGCCCTCTCTACTTGCATCTCC
CACATCATAGTTGTTATTTTATATTTTGTTCCTTGTATTTGTATGTATGTTAGACCTGTC
TGTACCTTCCCTTTTGATAAATCTATATCTGTTTTTTATACTGTCATCACTCCTTTGCTT
AATCCCTTAATCTATACCTTGAGAAACACAGAAATGAAAAATGCCATGAGGAAGCTTTGG
AACAGAAACAAGATGTCTAGCAGTAAGGCAATGAATGCTTTGTCCAAGCAA


Conceptual translation

MENKNNVTEFILLGLTQNSQMQKVLFVIFSIMYILTMVGNILIIITITESKSLNSPMYLF
LAFLSFMDATYSTIIVPKMILDLLYEKKTISFQACMVQLFLEHVFGGAEVFLLVVMAYDR
YVAICKPLHYLIIMRWRVCIILLVVSCISGFMHSFIQLLFVFRLPFCGPNVIDHFACDIY
PLLKLSCTNTYIIGFSVVANAGAICTIVFLLLLISYGVILHSLKTQSLEGRRKALSTCIS
HIIVVILYFVPCICMYVRPVCTFPFDKSISVFYTVITPLLNPLIYTLRNTEMKNAMRKLW
NRNKMSSSKAMNALSKQ