Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR4AD1P Olfactory Receptor

Gene Symbol Modo-OR4AD1P
Organism Opossum
Family 4
Subfamily AD
Pseudo Yes
Location scaffold_13644:0-860,836 (+)

Sequence information


Nucleotide sequence

AATAACATCACAGAATTTATTCTGACTGGTCTGTCCTAGTAGGAGGAGGTGCAGCAAATA
TGCTTATTTCTTTTTATACTTTTTTAAACAATGTCTCTGGGAATTCCCTTATCCTCAATA
TCAGAATTCTCCCATGAACTTCTTCCACAGTCTCTTATCTTTGATTAATATTTTCTGTTG
TTATGTAACTGCTCCCAAGATGATTGTGAACTTCCAAGTTAAAGTCAAGGCCATCTCTTT
TGTAGACTCAACTCTTTGGGCCCATTTTGGTCTATATTAGGTATACGGACATTTCTAAGC
CCCTGCAGTATTCAACTATTATGGACCAGAGCATTTGTAGCATTTGTAGCATATTGATGG
TGAGTTCTTGGGTGGGGGCATTTATTCATTCTATTGTACAGACCCTTCTCACTATCCAGT
TGCCCTTCTGAGGTTTCAATCTGATTGACCATTACTTCTGTTGTGTCTGTGCCTTATTGA
AACTCGCCTACATTGATGCTTATGTGGTGTGGGTCATTGTGGTGGCCACTGATTGCACAA
TATCCTTGGCTTGCTTCATCATCTTTGTGGTCTCCTCTGCTATCATATTTCTCTCCCTCA
GGACCTGCTCCTCAGACAGGAAGTAAAGGCTCTCTGCACCTGTTCTTCATGCCATTGTGG
TAATTTTGTTCTTTGTACCTTGCATCTTCATCTATATGTGGCCCTCAATTAAATTGCCCA
GAAGATAACATGATAGTTGTGTTCTATACTATCATTGTGTTCTATACCATCATAACCCCA
GGCTGAATCTACTGATCTATAACCTGAGGAATGCAGAAGTAAAGAATGACTTAAAGATTT
GGTAGACCAAGAAAGTGATGGAAGAC


Conceptual translation

NNITEFILTGLS**E/GAANMLISFYTFLNNVSGNSLILN/QNSPMNFFHSLLSLINI
FCCYVTAPKMIVNFQVKVKAISFVD\LFGPILVYIRYTDISKPLQYSTIMDQSICSICS
ILMVSSWVGAFIHSIVQTLLTIQLPF*GFNLIDHYFCCVCALLKLAYIDAYVVWVIVVAT
DCTISLACFIIFVVSSAIIFLSLRTCSSDRK*RLSAPVLHAIVVILFFVPCIFIYMWPSI
K\PEDNMIVVFYTIIVFYTIITP/LNLLIYNLRNAEVKNDLKIW*TKKVMED