Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR4B10P Olfactory Receptor

Gene Symbol Modo-OR4B10P
Organism Opossum
Family 4
Subfamily B
Pseudo Yes
Location scaffold_13644:0-947,883 (+)

Sequence information


Nucleotide sequence

ATGGCCATAACAAATAACGTGGCCCAGTTAATCTTTACAGGACTCTTTCAGAAAGAAGCG
CAGAGAGTGTGTTTTCTGGTTTTTCTGCAAATGTATGTAGCCACAATTTTGGGCAATGGC
CTCATCATCTTGACAGTCAATACCAGCAAAATTCTGAATACCTCCATGTACTTCTTCCTC
GGCTACTTATCCTTATTAGATATCTGTTCCTAAATTCATTTCTGACTTATTGACTGAGAA
CAAAACCAGCTCTTTGGATGGCTGCATCACTCAGATCTTCTTTTTCTATTTATTTGGAGT
GTTGAGGTCCTCCTGTTCACAGTAATGGCCTATGACCAGTATGTGGCCATTTGTAAACTC
CTCCATTATATGACTATCATGAATGATCCTATGTGTCATGCACTGTTGTTTTGTTCCTGA
CTTAAGGGCATGTTTCACTCTGTCATTCAGATTCTCATGACTGTTCAGTTGCCTTTCTGT
GGTCCCAATGTCACTGATCACTATTTCTGTGACCTCCATCCCTTGTTCAAGCTTGCTTGT
ACTGATACTGTTGTGGAAGGAATTATTGTGTTTGCAATAGTGGTATGATGGATTCATGCT
TCCTTCTCCTTCTTATGTTGTCATCCTGGTTCACTTGAGAAACCAGTCATCAGAGGGGAG
ATGTGAGGCTCTCTCCACTTGTGCCTCTCACATTACTGTTGTTCTTTTATTCTTTTGTCC
TGCTTTCTTTCTCTACTTGAGGTCATCTTCTACCTTTACTGAAGACAAACTTGTGTCTGT
GTGTCTGTATTTTATATAGTGGTTACTCCAATGTAACGCACGAGCCgcctgtgacaacta
cagaggcatctcactactctccactgcttgaaagatctt


Conceptual translation

MAITNNVAQLIFTGLFQKEAQRVCFLVFLQMYVATILGNGLIILTVNTSKILNTSMYFFL
GYLSLLDIC\KFISDLLTENKTSSLDGCITQIFFFYLFG/VEVLLFTVMAYDQYVAIC
KLLHYMTIMNDPMCHALLFCS*LKGMFHSVIQILMTVQLPFCGPNVTDHYFCDLHPLFKL
ACTDTVVEGIIVF/NSGMM/FMLPSPSYVVILVHLRNQSSEGRCEALSTCASHITVVL
LFFCPAFFLYLRSSSTFTED/TCVCVSVFYIVVTPM*RTSRL*QLQRHLTTLHCLKDL