Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR4B8P Olfactory Receptor

Gene Symbol Modo-OR4B8P
Organism Opossum
Family 4
Subfamily B
Pseudo Yes
Location scaffold_13644:0-967,892 (+)

Sequence information


Nucleotide sequence

ATGGCTATTACCAACAATGTGACTCAGTTAATTTTTATGGGGGCTCTTCCAATGATCGAG
AAGCACAGAGAGTTTCATTTGTTGTTTTTCTTCCTGTGTACATGGCCACAATGTTGGGCA
ATGGCCTCATCATCTTGACTGTTAACATAAGCAAGAGTCTGAGCTCCCCCATGTACTTCT
TCCTCAGCCACCTCTCCTTAGTAGAGATTTGTTACTCCTCTACTATTGTTCCTAAGTTTA
TTTCTGGCTTATGTGACTGAGAATAAAACCATCTCATTGGATGGCTGCATGACCCAGATC
TTTTTTTCCCACTTCCTTGGAGTTGCTGAGATCTCTCTCTTCTCACAGTGATGAGCGTAT
GACCGGTATGTGGCCATCTGCAAACCCCTGCATTACATGACCATTATGAACCGTCCTGTG
TGCCATATGCTGGTGTTTAGCTCCTGGGTAGGGGGGTATGTTCCACTCTGTTATTCAGAT
TCTCATCACTGTCCAATTGCCCTTCTGTGGTCCCAATGTGATTGATCACTATTTCTGTGA
CCTCTATCCCTTGTGTCAAGCTTGCCTGCACTGATACTTTTGTGGCAGGAATTATTGTGT
TTGTCAATAGTGGTTTATTCTCTGTGGTTTCCTTTCTCTTCTTGGTTTCTTCTTATGTTG
TTATCCTGGTTCACTTGAGAAACCAGTCAGCAGAGGGGAGGCGCAAGGCTCTCTCCACCT
GTGCCTCCCACATCACTGTTGTTCTCTTATTCTTTGGTCCTGCCATCTTTCTCTACTTGA
GGCCCTCTTCCACCTTTACTGAAGACAAACTTGTGTCTGTGTTCTATACAGTGCTTACGC
CCAATGTTGAACCCCATCATCTATACCTTGAGAAATGCAGAAGTGAAGAATGCAATGAGG
AGGTTGTGGGTCAAGATAATGAACTTGGGAGGGGAA


Conceptual translation

MAITNNVTQLIFMGAL/NDREAQRVSFVVFLPVYMATMLGNGLIILTVNISKSLSSPMY
FFLSHLSLVEICYSSTIVPKFISGL\TENKTISLDGCMTQIFFSHFLGVAEISLFSQ**
AYDRYVAICKPLHYMTIMNRPVCHMLVFSSWVGGYV\SVIQILITVQLPFCGPNVIDHY
FCDLYPL\KLACTDTFVAGIIVFVNSGLFSVVSFLFLVSSYVVILVHLRNQSAEGRRKA
LSTCASHITVVLLFFGPAIFLYLRPSSTFTEDKLVSVFYTVLTP\LNPIIYTLRNAEVK
NAMRRLWVKIMNLGGE