Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR4C33P Olfactory Receptor

Gene Symbol Modo-OR4C33P
Organism Opossum
Family 4
Subfamily C
Pseudo Yes
Location scaffold_19209:0-2,603,460 (-)

Sequence information


Nucleotide sequence

ATGAGAAACAATGTGACTGAATTCATTCTTCTTGGACTGACTCAGGATCCAGAAACACAG
AAAATTGTATTTTTCATTTTCTTGGTATTCTACACTGCCACTGTATTGGGAAACCTGCTC
ATTGTTGTGACAATCAAAATGAGTTCAACACTTGAGTCCCCGATGTACTTCTTCCTAACT
TACTTATCAATCGCAGATTCTTGCTTCTCTACCACCACAGCTCCCAAACTAATTTTGGAC
AACCTCTCCCACAAGAACACTATTTCCTTTGATGAGTGTATGACCCAAATGTTTGCTATG
CATTTCTTTGGCTGCATGGAAATACTGGTCCTCATTTTGATGGCCTATGACCGTTATGTG
GCCATCTGTAAGCCTTTGCACTATTCAGTCATCATGAACCGAAGGGTGTGTGGGATCCTC
ATTCTGCTGGCCTGGGTAGGGTCATTTCTTCATTCAATTGCCCAGATAATCCTCATCTTG
AATGTGCCTTTCTGTGGTCCAAATGTGATTGACCACTTTTTCTGTGATATACAACCTTTG
TTGAGGCTGGGTTGTATGGACACGTATGTCCTAAACCTCTTAGTAGTTTCTAATAGTGGG
GTCATATGCTCAGCCAGCTTTGTTTTGGCTAATGATATCCTATACAATTATACTACGCTC
CCTTAAAAATCACAGTGCAGAGGGGAAGCGGAAAGCCCTCTCCACCTGCAGCTCCCACAT
CACTGTTGTCATAATATTCTTTGGTCCCTGCATATTTATCTACACCCGGCCCCAAACTAC
TTTCCCACTGGATAAGTTGGTGTCTGTATTTTATACCATTATGACACCCTTTCTCAATCC
CTTGATCTACACTCTAAGGAATGCAGAAGTAAAAAATGCCATGAAGAAGTTGTGGAATAA
AAAAGTGCCTTCACATCAC


Conceptual translation

MRNNVTEFILLGLTQDPETQKIVFFIFLVFYTATVLGNLLIVVTIKMSSTLESPMYFFLT
YLSIADSCFSTTTAPKLILDNLSHKNTISFDECMTQMFAMHFFGCMEILVLILMAYDRYV
AICKPLHYSVIMNRRVCGILILLAWVGSFLHSIAQIILILNVPFCGPNVIDHFFCDIQPL
LRLGCMDTYVLNLLVVSNSGVICSASFVL\MISYTIILRSLKNHSAEGKRKALSTCSSH
ITVVIIFFGPCIFIYTRPQTTFPLDKLVSVFYTIMTPFLNPLIYTLRNAEVKNAMKKLWN
KKVPSHH