Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR4C68P Olfactory Receptor

Gene Symbol Modo-OR4C68P
Organism Opossum
Family 4
Subfamily C
Pseudo Yes
Location scaffold_19209:0-2,646,640 (-)

Sequence information


Nucleotide sequence

ATGAGAAACAATGTGACTGAATTCATTCTTCTTGGACTGACTCAGGACCCAGAAAGACAG
AAAATTGTATTTTTCATTTTCTTGGTATTCTACACTGCCACTGTATTGGGAAACCTGCTC
ATTGTTGTGACAATCAAGACCAGTTCAACACTTGGGTCTCCGATGTACTTCTTCCTAACT
TACTTATCTATCACAGATTCTTGCTTCTCTACCACCACGGCTCCCAAACTGATTTTGGAC
ACCCTCTCCCACAAGAACACTATTTCCTTTGATGAGTGCATGACCCAAATATTTGCTTTG
CATTTCTTTGGTGCCCATGGAAATACTGGTCCTCATTTTGATGGCCTATGACCGTTATGT
GGCCATCTGTAAGCCTTTGCACTATTCAGTTATCATGAACCGAAGGGTGTGTGGAATCCT
CATTCTGCTGGCCTGGGCAGGGTCATTTCTTCATTCAATCGCCCAGATAATCCTCATCTT
GAATGTCCCTTTCTGTGGTCCAAATGTGATTGACCACTATTTCTGTGATTTACAACCTTT
GTTGAGGCTGGGGTGTATGGACACGCATGTCCTAAACCTCTTGGTAGTTTCTAATAGTGG
GGCCTTATGTTCAACCAGCTTTGTTTTGCTAATGATATCCTATACAATTATACTACACTC
CCTTAAAATCATAGTGCAGAGGGGAAGCGGAAAGCCCTCTCCACCTGCAGCTCCCACATC
ATTGTTGTCATCATATTCTTTGGCCCCTGCATATTTATTTACACCCGGCCCCAAACTACT
TTCCCACTGGATAAGTTGGTGTCTGTATTTTATACCATTATAACACCCTTTCTCAATCCT
TTGATCTACACTCTAAGGAATGCCGAAGTAAAAAATGCCATGAAAAAGTTGTGGAATAAA
AAAATGATTTCAGAT


Conceptual translation

MRNNVTEFILLGLTQDPERQKIVFFIFLVFYTATVLGNLLIVVTIKTSSTLGSPMYFFLT
YLSITDSCFSTTTAPKLILDTLSHKNTISFDECMTQIFALHFFGA\EILVLILMAYDRY
VAICKPLHYSVIMNRRVCGILILLAWAGSFLHSIAQIILILNVPFCGPNVIDHYFCDLQP
LLRLGCMDTHVLNLLVVSNSGALCSTSFVLLMISYTIILHSLK/HSAEGKRKALSTCSS
HIIVVIIFFGPCIFIYTRPQTTFPLDKLVSVFYTIITPFLNPLIYTLRNAEVKNAMKKLW
NKKMISD