Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR4D16P Olfactory Receptor

Gene Symbol Modo-OR4D16P
Organism Opossum
Family 4
Subfamily D
Pseudo Yes
Location scaffold_12795:0-3305344 (+)

Sequence information


Nucleotide sequence

ATGGAGCTGGGAAATCACACCAGGGTGAAAGAATTTATTTTTCTGGGGCTGACCCAATCT
CCAGAGTTGAGCATCCATCTTATTTCTTTTATTATTCCTGGTGTATGTTACAACTCTCCT
GGGCAATCTTCTTATCATGGTCACTGTGACTTGTGAGTCTCGCCTCCACACACCAATGTA
TTTCCTTCTCCGAAATCTCTCTATTGTGGACATTTGCTTCTCCTCCATCACCACTCCAAA
GATTTTACTTGACCTCCTAGTTAAGAGGAAGACCATCTCTTTCAATGGCTGCATGACACA
GATATTTTTCTTCCACCTCATTGGTGAGGGTCGATATTTTTACTCTCTCTGTCATGGCTT
ATGATCGTTACTTGGCAATCTCAAAGCCTCTTCATTATGTGACCCTCATGAGTAAGGGAA
GGTGTTTTGGGCTCCTTGTGGCCTCCTGGGTGGGGGGCTTCATACATTCCATTGTGCAGA
TCTCTCTGTTGCTCCCACTCCCATTCTCTGGGCCCAATGTCATTGATGGTTTCTACTGTG
ATGTCCCCCAAGTCCTCAAACTGGCCAACACTGATACCTTTACTCTGGAGCTCCTTATGA
TCTCCAACAATGGTCTAGTCACCACCCTTTGGTTCTTTCTACTCATTGCGTCCTACACGG
TCATCATGGTGATGTTGAGATCTCACACAGGAGAGGGCAAGAGAAAAGCCATCTCAACCT
GCTCTTCCCACATCACTGTGGTCACCGTACATTTGGTGCCCTGTATCTATGTATATGCCA
GGCCCTTCTCTGCCCTTCCCTCTGACCGAGTCATCTCTGTCACATTCACTGTCATCTCCC
CTCTCTTGAATCCCATGATTTACACTCTGAGAAACCAGGAGATGAAGTCAGCTATAAGAA
GACTACAGAAACAACTTGTACCTTCTACAAAGGAATTG


Conceptual translation

MELGNHTRVKEFIFLGLTQSPEL\SILFLLLFLVYVTTLLGNLLIMVTVTCESRLHTPM
YFLLRNLSIVDICFSSITTPKILLDLLVKRKTISFNGCMTQIFFFHLIG\VDIFTLSVM
AYDRYLAISKPLHYVTLMSKGRCFGLLVASWVGGFIHSIVQISLLLPLPFSGPNVIDGFY
CDVPQVLKLANTDTFTLELLMISNNGLVTTLWFFLLIASYTVIMVMLRSHTGEGKRKAIS
TCSSHITVVTVHLVPCIYVYARPFSALPSDRVISVTFTVISPLLNPMIYTLRNQEMKSAI
RRLQKQLVPSTKEL