Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR4Y7P Olfactory Receptor

Gene Symbol Modo-OR4Y7P
Organism Opossum
Family 4
Subfamily Y
Pseudo Yes
Location scaffold_19209:0-1,909,720 (-)

Sequence information


Nucleotide sequence

ATGGAAGCTAAAGGCAATGTTACACAATTCATTCTCTTTGGACTTTCCTATGACCCAAAT
ATACAGATATTTTGTTTCTTTCTCTTTCTATTCTGTTATATTAGTCTCATTTTGGGAAAC
CTCTTAATCCTCATCTCTATTCATTGTAGTCATCTTTTCCACCAACCAATGTACTATTTC
CTTAGTCACTTATCTTCTATGGACATCTATTATACTTCCAGTGTTACACCAAAATTAATT
GCAGATTTGTTAACTGAGAAAAAAACCATCTCTTATGGCTATTGTATGGTCCCAAGTCTT
CTCTATTCACTTCTTTGGCAGTATTGAGGTCTTCATCCTGACCGCAATGGCCTTTGACCG
CTATGTTGCCATCTGTAAACCTCTCCATTACATGGTCATCATGAGCAGGAAGAAAGTGCA
ACCTTCTTGTTTTAGCTGCTTGGGGAGGTGCGGCTGCCCATTCCTTTTCTCAATTGTCCA
TGACTGTTAAGTTACCCTTCTGTGGCCCCAATGAAATTGATCACTATTTCTGTGACATCT
TCCCCTTACTGAAAATTGCCTGCACAGACACCTACATCACTGGTGTTCTTCTTGTCCTCA
GTTCAGGGATAATTGCCTTGGGAGTCTTTGTGATATTATTTGTTTCTTATGCTGTTATAT
TATGGACCCTTCGCACACATTCAGCTGAAGGGAGGCGGAAAGCTCTCTCTACCTGTGGAT
CTCATTTCACGGTTGTCATTTTGTTTTTTGTACCTGCCATTTTTTCCTACCTTCGACCTC
CCACCACCTACCCTGAGGATAAAGTATTTGCTCTATTTTATACTATCATTGCTCCAATGT
TCAACCCTCTAATTTACACTTTGAGAAATACTGAGATGAAAAATGCCATGAGAAAGGTAT
GGTGTCAAAAGTTATTCGGGAAAGGAAATGTA


Conceptual translation

MEAKGNVTQFILFGLSYDPNIQIFCFFLFLFCYISLILGNLLILISIHCSHLFHQPMYYF
LSHLSSMDIYYTSSVTPKLIADLLTEKKTISYGYCM\QVFSIHFFGSIEVFILTAMAFD
RYVAICKPLHYMVIMSR\KCNLLVLAAWGGAAAHSFSQLSMTVKLPFCGPNEIDHYFCD
IFPLLKIACTDTYITGVLLVLSSGIIALGVFVILFVSYAVILWTLRTHSAEGRRKALSTC
GSHFTVVILFFVPAIFSYLRPPTTYPEDKVFALFYTIIAPMFNPLIYTLRNTEMKNAMRK
VWCQKLFGKGNV