Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR51A32P Olfactory Receptor

Gene Symbol Modo-OR51A32P
Organism Opossum
Family 51
Subfamily A
Pseudo Yes
Location scaffold_16805:0-2,689,460 (-)

Sequence information


Nucleotide sequence

ataaaaatatgtttaaatttgaggaaaaaaaaaaaGAATCCTCCTAACTACTGCCAGGAT
TTCCAAAATGGGGCTGGTTATGGCTATCAGGAACTTCTTTTTAGTGCTTCCATTTCCCTT
AACACTAAAGAGGCTGCGCTATTGTCACAAAAACGTCCTATCCCACTCCTATTGTTTCCA
TCACGATGTTATGAAGCTGGCATGCAGTGACAACAGAGTCAATGTTATCTATGGATTCTT
TGCTGCCCTCTGTACCATAATGGACCCGGTATGCATCGCTTTGTCCTATTTACTAATCCT
AAAAATAGTTCTTGGATTTGCCTCTTTCTCAGAGAGACTCAAAGCCTTCTAATATGTGTG
TCTCTCACATCTGTGCAGTGTTCATCTTCTATGTGCCTATCATTACCCTAGCTGCTATGC
ATAGCTTTGCCAAGCACAAATCTCCACTCAATAATCTTCATTGCTAACATCTTCCTTCCT
AACATCATGGGTGACACCCCTGGTGAATCCCATTATGTATTGTGTGAAGAACAGGCAGAT
C


Conceptual translation

IKICLNLRKKKKNPPNYCQDFQ/WGWLWLSGTSF*CF/FPLTLKRLRYCHKNVLSHSY
CFHHDVMKLACSDNRVNVIYGFFAALCTIMDPVCIALSYLLILKIVL\LPLSQRDSKPS
NMCVSHICAVFIFY\LSLP*LLCIALPSTNLHSII\LLTSSFLTSWVTPLVNPIMYCV
KNRQI