Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR51AC1 Olfactory Receptor

Gene Symbol Modo-OR51AC1
Organism Opossum
Family 51
Subfamily AC
Pseudo No
Location scaffold_16805:0-1,814,440 (-)

Sequence information


Nucleotide sequence

ATGACTCGAGTCACAAAGAGTCACTATGTTTTGAATCTGAATGGTAGCCAATTCCAGCCA
CCCTTCTTCCTCCTGACAGGCATCCCAGGTTTAGAAGCAGCACATATCTGGATCTCTATT
CCTTTGTGCGTGTTGTACATGATTGCTTTACTTGGAAACTCTAGCATTCTCTTCATCATT
AAGACCACTCCCAGCCTTCATGAACCTCAATACATCTTCTTGACCATGCTGGCAGCTACA
GATATTGGCCTTTCTATATCCACATTGCCAACAGTGCTCAAGGTCTTCCTCCTCAACCAC
AGGGAAATAGAGTTTCACTGCTGCCTGACACAGATGTTTTTCATTCATACCTTTTCTTCC
ATTGATTCTGCAATCCTGTTGGCCATGGCCTTTGATCGCTTTGTGGCCATCAGAAATCCA
TTGCACTACACCATGATCCTTACCCATGCCAAGATAATTAGAATGGGACTAGCAGCTGTG
GTGAGGGGTGTGGCACTGATGACAGCCTGGCCTATCCTGCTCAAGTGGCTACCCTTCTGC
AAGAACATCATCCTCTCCCACTGCTATTGCTACCATCCCGATGTTATGAAGCTGGCCTGT
GGACCTGTCAGAGTCAACATTATTTATGGGCTAGCAGTTGTACTTTGTTCTTTTGGTCTT
GACTCTTTGTTCATTATTATCTCCTATGCGCTTATCCTGAAGACAGTTATGAGCATTGCT
TCCAATGAAGGTCGTCTTAAGGCCCTCAACACTTGTATCTCCCACATAGTCACGGTCTTT
ATCTTCTATGTGCCACTTATTATTCTGGCCCTAATACACAGATTTGGAACATTCACTTCG
CCTCTAATTCACGTCACTATGGCCAACCTTTTCCTCTTCCTAACTCCAGTAATGAATCCA
CTGGTCTATAGCTTTAAAACCAAACAGATTCGCTCTGTCATTCAAAAGGCATTTGTAACA
AGAGGCAGT


Conceptual translation

MTRVTKSHYVLNLNGSQFQPPFFLLTGIPGLEAAHIWISIPLCVLYMIALLGNSSILFII
KTTPSLHEPQYIFLTMLAATDIGLSISTLPTVLKVFLLNHREIEFHCCLTQMFFIHTFSS
IDSAILLAMAFDRFVAIRNPLHYTMILTHAKIIRMGLAAVVRGVALMTAWPILLKWLPFC
KNIILSHCYCYHPDVMKLACGPVRVNIIYGLAVVLCSFGLDSLFIIISYALILKTVMSIA
SNEGRLKALNTCISHIVTVFIFYVPLIILALIHRFGTFTSPLIHVTMANLFLFLTPVMNP
LVYSFKTKQIRSVIQKAFVTRGS