Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR51AI2 Olfactory Receptor

Gene Symbol Modo-OR51AI2
Organism Opossum
Family 51
Subfamily AI
Pseudo No
Location scaffold_16805:0-1,003,930 (+)

Sequence information


Nucleotide sequence

ATGCCAAACCTGCCCAGGACCAACTTCAGCTTCACCACCTTCTTGCTGACTGGTTTCCCA
GGCCTGGAATGGGCTCACTGTTGGATCTCCCTGCCCATCTTTGCAGGCTACCTAGTGGCT
CTTCTGGGCAACATCACCATCCTGCACCTGGTCCGCACTGAGAACTCCCTGCACCAGCCC
ATGTACTACTTCCTGGCAATCCTAGCAGTGACAGACCTGGGTCTCTGCATGTCCACTCTG
CCCACAGTGCTGGGTGTGCTGTGGTTTGATGCACGGGCCATTGGGCTGGTGTCTTGTATT
CTGCAGCAGCATTTCCTCCACTCCTTCTCTTTCATGGAGTCTGCTGTGCTTTTTGCCATG
TCCCTGGACCGCCTGGTGGCCATTCGCTTCCCACTGCGCTATGCCACAATTCTCTCTGGC
CCCCGTGTGGCACTGGCTGGGGCAATACTGGGTCTGAGGAGTGCTGCTATCACAGCAGCC
CCCTCAATCCGCTTGTTCACTTTCCAGTACTGCCGCCCTGGAGCCCTCTCTCATGCTTAC
TGCTTACATCAGGACATGATCCGTCTGGCCTGTTCTGACACACGCTTCAACAGCATCTAT
GGGCTGTGCATTATCATGTTGGCCATGGGCTCCGATGTTCTCTTTATCCTGATCTCCTAT
ACCATTATTCTCTACACTGTACTCTCCATTGCCTCTGCCAGGGAGAGACTAAAAGCCCTC
AACACATGTGTGTCCCACATCCTGGCTGTGTTGTGTTTCTATGTGCCTGTGCTTGGCTTA
TCCATTGTTCACCGCTTTGGACGCCATGCTTCCCCTGTTGTGCATGTGCTTATGGGTACA
GTTTCAGTACTTTTTCCTCCTTTGATGAATCCTGTGATCTATAGTGTCAAGACACATCAG
ATCCGTCGAGCCATCCTCAAGGTAGTCTCTTTGGGGAAACTCCGG


Conceptual translation

MPNLPRTNFSFTTFLLTGFPGLEWAHCWISLPIFAGYLVALLGNITILHLVRTENSLHQP
MYYFLAILAVTDLGLCMSTLPTVLGVLWFDARAIGLVSCILQQHFLHSFSFMESAVLFAM
SLDRLVAIRFPLRYATILSGPRVALAGAILGLRSAAITAAPSIRLFTFQYCRPGALSHAY
CLHQDMIRLACSDTRFNSIYGLCIIMLAMGSDVLFILISYTIILYTVLSIASARERLKAL
NTCVSHILAVLCFYVPVLGLSIVHRFGRHASPVVHVLMGTVSVLFPPLMNPVIYSVKTHQ
IRRAILKVVSLGKLR