Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR51AL1P Olfactory Receptor

Gene Symbol Modo-OR51AL1P
Organism Opossum
Family 51
Subfamily AL
Pseudo Yes
Location scaffold_16805:0-2,562,500 (+)

Sequence information


Nucleotide sequence

attctaacctaattcccaagtattagtgcccagttattggaaattatattgacaacattg
tgcctttaatttttttatgtctatgttattttcctcagatgggatgtaatcctcttaaag
acaagaactttttcatcttaatctttgtatacccactatgtaacatagttggcacatgcc
aAAAATGCTTATTTCATAGATTGAACACATTTACATAGCTGCATTTGCTTTGGTTGCTAA
TTATATTGATCATTTCTTCAAGGTTGCACCATCCTTGAATCTTCTGTTTCATTACAAATT
GAAAATACAGATTTGGGGAGAGAGATTTGCTGTTAATCATTTTGCTAAATTTTCATTTTT
GCATCTATTTTCATTAGTCAATTTTCTCCTATGTCTCTTTCGATATGTCTTTGAATATTA
ATAGCTATTTCTTTCAGACATGGAAAAAATGAAAATGCATTCTTTATCAGTTATTGTTTT
CTGTCCCATTCTTACTGACTCCATCAAGATGTCATGAAGTTAGATTGCTCTGATAATTGG
ATCAATCAATGTTATCTATGGCTTCTTTGGAGCCCTATGCAACATGGGTAACTTTCTGCT
CATTGTTGTGTCCTACATACTGATATTGAAGACTGTGCTGGGGATTGCATCTCACACATC
TGTGTGGTAATCATTTTCTATGTACCCATTATCACCCTGGCTGTTGTTCATCAATTTGCA
AGACATGCTTCTCCTATTTTTAATATTGTTATGGCCAATCTTCTCTTGATAGTACCACTC
ATAATGAACCCTCTTGTGTATTGTATAAAAACCCGCCAGATCTAGGAGAGAGTCCTACAG
CACCTGAGAATAAAA


Conceptual translation

ILT*FPSISAQLLEIILTTLCL*FFYVYVIFLRWDVILLKTRTFSS*SLYTHYVT*LAHA
KNAYFID*THLHSCICFGC*LY*SFLQGCTILESSVSLQIENTDLGREICC*SFC*IFIF
ASIFISQFSPMSLSICL*ILIAISFRHGKNENAFFISYCFLSHSY*LHQDVMKLDCSDNW
INQ\IYGFFGALCNMGNFLLIVVSYILILKTVLGIASHTSVW*SFSMYPLS/LAVVHQ
FARHASPIFNIVMANLLLIVPLIMNPLVYCIKTRQI*ERVLQHLRIK