Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR51L12P Olfactory Receptor

Gene Symbol Modo-OR51L12P
Organism Opossum
Family 51
Subfamily L
Pseudo Yes
Location scaffold_16805:0-1,552,850 (+)

Sequence information


Nucleotide sequence

AATTCCAGTAGTTCTCTGTCCACTATATTTTATCTCACTGGAATTCCTGGATATGAGGAA
CTATACCACTGGATCTCCATCCCTTTCTTCATTCTCTACATGATTGGGAATACTGGGAAA
CTGTACCATCCTTCATATTGTCCGGACTGACCCAAGCCTCCATGAACCCATGTATTATTT
CTTGGCCATGCTCTCCCTCACTGATATGGGCATGTCCCTTCCCACACTTGTATCTGTCTT
CAGAGTTTTGTGGTTCATTTCTAATGAGATTGAATTCAACACATGTGTAATACAGATGTT
TTTTATTCATACTTTCTCCTTAACAGAATCTGCAGTGCTCCTAGCAATGGCCTTTGACCG
CTATGTAGCCATCTGTCATCCCCTGAGGTATTCCACCATCCTCACCCCAAAGCGCATCAT
TAAGATTGGAATAACAGCTATTTTGAGGAGCTCTCTCACCAGTACTCCACCATTGGTCAG
TCTTGCCTACTTTCCTTACTGCCACTCTCATGTTCTTTCTCACTCATACTGCCTACATCA
GGATATGATTCACTTGGCTTGTGCTGACACTAAATTTAATGTCATCTATGGAGTGGTTGT
GATCATTATTCTCTGGGGATTTGATGCCTTGGGCATTCTTATTTCTTACATCTTCATTCT
CCGTTCTGTACTGAGCATTGCATCCCCAGAAGGAAAGACTCAAGGCTCTCAACACATGTG
CCTCCCACATCTGTGCTGTTCTCATCCTTTATGTGCCCATGATTGGTCTATCTCTTGTTC
ACCGTTTTGCAAAACATGCCTCTCCCCTTGTCCATATTTTCATGGCTCATATCTACTTGT
TGGTGCCCCCCATACTCAACCCTATCATTTACAGTGTGAAGACCAAACAGATTCGTGTAG
GGATCATTCGTCTACTTCTCCCTAAGAAAATCCACTCTACCTGG


Conceptual translation

NSSSSLSTIFYLTGIPGYEELYHWISIPFFILY\LGILGNCTILHIVRTDPSLHEPMYY
FLAMLSLTDMGMSLPTLVSVFRVLWFISNEIEFNTCVIQMFFIHTFSLTESAVLLAMAFD
RYVAICHPLRYSTILTPKRIIKIGITAILRSSLTSTPPLVSLAYFPYCHSHVLSHSYCLH
QDMIHLACADTKFNVIYGVVVIIILWGFDALGILISYIFILRSVLSIASPEG\LKALNT
CASHICAVLILYVPMIGLSLVHRFAKHASPLVHIFMAHIYLLVPPILNPIIYSVKTKQIR
VGIIRLLLPKKIHSTW