Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR52A20P Olfactory Receptor

Gene Symbol Modo-OR52A20P
Organism Opossum
Family 52
Subfamily A
Pseudo Yes
Location scaffold_16805:0-432,650 (+)

Sequence information


Nucleotide sequence

ATGGCACAATCTTCATGCCATCGCTGCTTTTTTCTGATTGGGATACCTGGCCTAGAGACT
GTGCAGTGCTGGATTGGAATTCCATTCTGTGCCATGTATGTCATTGCCATGGTTGGAAAT
TACCTGCTCCCTGTTCATCATTCGATCTGAAAGCAGTCTCCACAAGCCCATGTATCTCTT
CTTGGCATGTGGGGGGTCACTGATATTGCCCTCAGTACTTGCATCCTCCCCAAGATGTTG
GGCATCTTTTGTTTCATCTGAAGGAAATCTACTTTGAGGCCTGCCTGCTGCAAATGTGGC
TCATTCACACATTCCAGTGCATAGAGTCAGGCATCTTATTGGCCATGGCTCTGGACCGAT
ATGTGGCCATCTGTGATCCCCTGAGGCACACTACTATTTTCACCCCACAACTGCTCACTC
AGATTGGGGTTGGGGTGACCTTAAGGGCTGCTATCCTGGTGGCCCCATGCCTTGTGCTTA
TCAAATGCCGCCTGAAACATTACCGAACAACAGTCATTTCCCACACTTACTGCGAGCACA
TGGCCATTGTAAAAGCTGGCTGCTGATGACATCCGGGTCAACAAGGCCTATGGTTTGTTT
GTGGCCTTTACTATCCTGGGCTTTGACATTATCTTCATTACCCTGTCCTACATTTTGATC
TTCATAGCAGTGTTCCGTTTACCCCAGAAAGAGGCCCGCCTCAAAGCCTTCAACACCTGC
ATTGCTCACATCTTTGTTTTCCTTGAATTCTATCTCCTTGCTTTCTTCTCTTTTTTCACT
CATCGGTTTGGATTCCACATCCCCCCCTATGTCCACATCCTCCTCTCTAACCTGTATCTA
TTGGTTCCACCTCTTCTCAACCCCATTGTCTATGGTGTAAAGACCAAGGAAATTAGGAAT
CGCATCATCAAAATGCTCAACTAT


Conceptual translation

MAQSSCHRCFFLIGIPGLETVQCWIGIPFCAMYVIAMVGNYLL\FIIRSESSLHKPMY/br/>LLLGMWGVTDIALSTCILPKMLGIFCFI/KEIYFEACLLQMWLIHTFQCIESGILLAMA
LDRYVAICDPLRHTTIFTPQLLTQIGVGVTLRAAILVAPCLVLIKCRLKHYRTTVISHTY
CEHMAIVKAGC\DIRVNKAYGLFVAFTILGFDIIFITLSYILIFIAVFRLPQKEARLKA
FNTCIAHIFVFLEFYLLAFFSFFTHRFGFHIPPYVHILLSNLYLLVPPLLNPIVYGVKTK
EIRNRIIKMLNY