Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR52A21P Olfactory Receptor

Gene Symbol Modo-OR52A21P
Organism Opossum
Family 52
Subfamily A
Pseudo Yes
Location scaffold_16805:0-482,106 (+)

Sequence information


Nucleotide sequence

ATTGGAATTCCATTCTGTGCCATGTATGTCGTTGCCATGGTTGGAAATTACCTGCTCCTG
TTCATCATTCGATCTGAAAGCAGTCTCCACAAGCCCATGTACCTCTTCTTGGCTATGTTG
GGGGTCACTGATATTGCCCTCAGTACTTGCATCCTCCCCCAAGATGTTGGGCATCTTCTG
GTTTCATCTGAAGGAAATCTACTTTGAGGCCTGCCTGCTGCAAATGTGGCTCATTCACAC
ATTCCAGTCCATAGAGTCAGGCATCTTACTGGCCATGGCTCTGGACCGATATGTGGCCAT
CTGTGATCCCCTGAGGCACACTACTATTTTCACCCCACAACTGCTCACTCAGATTGGGGT
TGGGGTGACCTTAAGGGCTGCTATCCTGGTGGCCCCATGCCTTGTGCTTATCAAATGCCG
CCTGAAACATTACCGAACCACAGTCATCTCCCACACTTACTGTGAGCACATGGCCATTGT
AAAGCTGGCTGCTGATGACATCCGGGTCAACAAGGCCTATGGTCTGTTTGTGGCCTTTAC
TATCCTGGGCTTTGACATTATCTTCATTACCCTGTCCTACATTTTGATCTTCATAGCAGT
GTTCCGTTTACCCCAGAAAGAGGCCCGCCTCAAAGCCTTCAACACCTGCATTGCTCACAT
CTTTGTTTTCCTTGAATTCTATCTCCTTGCTTTCTTCTCTTTTTTCACTCATCAGGTTTG
GATTCCACATCCCCCCCTATGTCCACATCCTCCTCTCTAACCTGTATCTATTGGTTCCAC
CTCTTCTCAACCCCATTGTCTATGGAGTAAAGACCAAGGAAATTAGGAATCGCATCATCA
AAATGTTTCACTAT


Conceptual translation

IGIPFCAMYVVAMVGNYLLLFIIRSESSLHKPMYLFLAMLGVTDIALS\ASSPKMLGIF
WFHLKEIYFEACLLQMWLIHTFQSIESGILLAMALDRYVAICDPLRHTTIFTPQLLTQIG
VGVTLRAAILVAPCLVLIKCRLKHYRTTVISHTYCEHMAIVKLAADDIRVNKAYGLFVAF
TILGFDIIFITLSYILIFIAVFRLPQKEARLKAFNTCIAHIFVFLEFYLLAFFSFF\IR
FGFHIPPYVHILLSNLYLLVPPLLNPIVYGVKTKEIRNRIIKMFHY