Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR52E20 Olfactory Receptor

Gene Symbol Modo-OR52E20
Organism Opossum
Family 52
Subfamily E
Pseudo No
Location scaffold_16805:0-2,231,880 (-)

Sequence information


Nucleotide sequence

ATGCCTTTATCCAATAATGCTAGTTCCTACCCCTTTTCATTCTTACTTCTTGGAATTCCT
GGTCTGGAAAACTTTCACATCTGGATTGGCTTTCCATTCTGTGCTGTCTATCTGATTGCC
TTAGTGGGAAACATCACTATCCTGACAGTGATTCGACTGGAACGAAGCCTCCACCAACCC
ATGTTCTACTTCTTGGCCATGCTGGCTTCCATTGACCTGGGCTTATCCACAGCTACCATC
CCCAAGATGATGGGTATCTTCTGGTTTAGCTTGAGAATGATCAGCTTTGGAGGTTGCCTC
ACCCAAATGTTCTTCATCCACATCTTTACTGGCATGGAGTCAATTGTGCTAGTGTCAATG
GCCTATGACCGCTATGTGGCTATCTGTAATCCTCTACACTATAGTTCTGTCCTCACCAAC
AAGATTGTAGCCTTGATGGGCCTTGGAGTACTGATGAGATCTTTTTTCATTTGTCTTCCC
TTTGTGTTTCTTATCCTAAGACTAACTTTCTGTGGACACTACATTATCCCTCACACCTAT
TGTGAACATATGGGATTGGCCCGCCTGGCCTGTGTAAACATAAGGATCAACATCATCTAT
GGCCTCTGGGCCATTTCCATATTGGTGTTGGACATGGTTGCCATTGCTATCTCATATGTG
CAGATTCTACGTGCTGTCTTTCGCCTCCCTTCTCGTGACGCCAGGCTCAAAGCTCTTAGT
ACATGTGGTTCCCATGTCTGTGTTATCTTGGCATTCTATAGCCCTGCACTCTTCTCCTTC
ATGACACACCGTTTTGGCAAGAATGTACCCCGTTATATTCACATCCTCCTGGCCAATATG
TATGTGGTCATCCCACCCATGCTTAACCCTGTTATCTATGGGGTTAGAACCAAACAGATT
CGGGAGAAGGTGTTGAGAGTATTCTGTACAAATAGCTTAGGT


Conceptual translation

MPLSNNASSYPFSFLLLGIPGLENFHIWIGFPFCAVYLIALVGNITILTVIRLERSLHQP
MFYFLAMLASIDLGLSTATIPKMMGIFWFSLRMISFGGCLTQMFFIHIFTGMESIVLVSM
AYDRYVAICNPLHYSSVLTNKIVALMGLGVLMRSFFICLPFVFLILRLTFCGHYIIPHTY
CEHMGLARLACVNIRINIIYGLWAISILVLDMVAIAISYVQILRAVFRLPSRDARLKALS
TCGSHVCVILAFYSPALFSFMTHRFGKNVPRYIHILLANMYVVIPPMLNPVIYGVRTKQI
REKVLRVFCTNSLG