Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR52E33P Olfactory Receptor

Gene Symbol Modo-OR52E33P
Organism Opossum
Family 52
Subfamily E
Pseudo Yes
Location scaffold_16805:0-2,215,180 (-)

Sequence information


Nucleotide sequence

ATGCCCCATTACAATGATACTCAATTCCATCCTCCCTTTTTCATATTACTGGGCATTCCC
AGTCTGGAAAATTTTCACATTTGGATTGGCTTCCCTTTTTGCATTGTGCATCTTATTGCT
CTCTTGGGAAATATCACCATATTGTTTGTGATCCAGACTGAAAAGACACTTCACCAGCCC
ATGTTCTACTTTCTGGCCATGTTGGCCACCATTGACCAAGGACTATCTACAACGACTATT
CCCAAGATGTTGGGCATCTTTTGGTTCAAACTGAGGGAAATCACCTTTGGTACCTGTCTC
ACACAGATGTTCTTTATCCATTTGTTGACTTTTGGATGGAATCAGCTGTCCTATCTTCTA
TGGCCTATGATCGCTATGTGGCAATCTGTAATCCCTTGCATTACAGCACTGTCCTCACCA
ACAGAGTGGTGGCCATAATGGGCATTGTGGGAGTGGTAAGGTCTTTCTTTGCAGTGATTC
CTTGTGTATTCCTGGTCCTTCGACTTCCTTTCTGTGGAAATCGTGTCATTCCTCACACCT
ACTGTGAACACATGGGCATTGCTCGATTGGCTTGTGCTAGCATCAGAGTCAATATGATCT
ATGGGCTTTGTGCTATTGGTACTCTGATATTTGACATTGTAGCTATTGCTGTATCCTACA
TCCTGATTCTCCAAGCTGTTTTTCACCTCCCTTCCCATGATGCTAGGCTGAAAGCCTTGA
GCACTTGTGGCTCCCACGTCTGTGTCATCTTAGCCTTTTATACTCCTGCCTTATTCTCTT
TCATGACCCATCGCTTTGGCCAGAATGTCCCTCGGGACATCCATATCCTCCTGGCCAACT
TGTATGTCATTGTCCCACCTATGTTTAACCCTGTCATCTATGGAGTTAGGACCAAGCAGA
TCAGAGAAAAGGTGTTTAAGATGCTACTCAAGAAC


Conceptual translation

MPHYNDTQFHPPFFILLGIPSLENFHIWIGFPFCIVHLIALLGNITILFVIQTEKTLHQP
MFYFLAMLATIDQGLSTTTIPKMLGIFWFKLREITFGTCLTQMFFIHLLTFGWNQ/VLS
SMAYDRYVAICNPLHYSTVLTNRVVAIMGIVGVVRSFFAVIPCVFLVLRLPFCGNRVIPH
TYCEHMGIARLACASIRVNMIYGLCAIGTLIFDIVAIAVSYILILQAVFHLPSHDARLKA
LSTCGSHVCVILAFYTPALFSFMTHRFGQNVPRDIHILLANLYVIVPPMFNPVIYGVRTK
QIREKVFKMLLKN