Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR52H14P Olfactory Receptor

Gene Symbol Modo-OR52H14P
Organism Opossum
Family 52
Subfamily H
Pseudo Yes
Location scaffold_16805:0-498,821 (-)

Sequence information


Nucleotide sequence

TTTATCTTAGTGGGGATCCCAGGGCTTGAGAAGTTCCACATCTGGGATTGCGATTCCCCT
TCTGTGTTATCTACCTTGTGGCCATTGTGGGTAACTGTGTCCTGCTGTACCTCATTGCTG
TGGAGCACAGCCTCCATGAGCCCATGTTCTTTTTCCTGTCCATGCTGGCCAAAACTGACC
TCATTTTGTCATCTACAACAATGCCCAAATTACTCAGTAACCTCTGGTTTGGTGACAAGA
AAATCACTTTCTCGGGCTGCCTCACCCAGATGTTCTTCCTCCATTTCAGCTTTGTTGTAG
ATTCTGCAATACTGTTGGCCATGGCCTATGACCGCTATGTGGCCATATGCTCCCCACTGA
GATACACCACCATTCTGACCCACCAGGTCATCATCAAGATTGTGGTGGGAATCATCTTCA
GGAGCTTCTGTGTCATCTTGCCAGATGTTTTCTTGCTAAAACGACTACCCTTCTGCCGAA
CACGCATCATCCCCCATACATACTGTGAACACATAGGTGTAGCTCGACTTTCTTGTGCTG
ACATCTCCATCAACATTTGGTATGGCTTTGCTGTGCCACTTATGACTGTAGTCTCTGACA
TTGTCCTCATTGCTGTCTCTTATACCATTATCCTGAGTGCAGTCTTTCGCCTCCCTTCTC
GTGGTGCCCGCCAGAAGGCTTTGGGAACCTGTGGATCTCATGTCTGTGTCATCCTTTATG
TTCTATACCCCTGCCTTCTTCTCTCATCCTTGCTCATCGCTTTGGACATGATGTCCCACG
TCATGTCCTCATCTTATTTGCCAATTTTTATGTTGCTATTCCTCCAGCTCTTAATCCTAT
TGTCTATGGAGTAAAGACAAAGCAAATTCGAGATAAGATTCTTCTCCTGTTTTCTCCAAA
GGGAACA


Conceptual translation

FILVGIPGLEKFH/LGLRFPFCVIYLVAIVGNCVLLYLIAVEHSLHEPMFFFLSMLAKT
DLILSSTTMPKLLSNLWFGDKKITFSGCLTQMFFLHFSFVVDSAILLAMAYDRYVAICSP
LRYTTILTHQVIIKIVVGIIFRSFCVILPDVFLLKRLPFCRTRIIPHTYCEHIGVARLSC
ADISINIWYGFAVPLMTVVSDIVLIAVSYTIILSAVFRLPSRGARQKALGTCGSHVCVIL
\FYTPAFFSHPCSSL\HDVPRHVLILFANFYVAIPPALNPIVYGVKTKQIRDKILLLF
SPKGT