Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR52S10P Olfactory Receptor

Gene Symbol Modo-OR52S10P
Organism Opossum
Family 52
Subfamily S
Pseudo Yes
Location scaffold_16805:0-1,561,030 (-)

Sequence information


Nucleotide sequence

ATGATATTATCTAACAAGACCAATGTTCATCCTTCCACTTTCATTCTCATTGGAATTCCA
GGACTGAAGACTGCTCAATCTGGATCTCCATCCCTTTCTGCATGGTGGACATATTGCCTC
TTCTGGGAATCTTTGCTCTGCTTTTTATCATCAAAACTGACCAAAGCCTTCATGAGTCCA
TGTACCTCTTCCTAGGCATGTTGGCTGTGACAGACCTGTTTGTGTGTACCACTGCTATTC
TCAAGCTTCTCAGCCTCTTTTTGTTCAAAGACTGGGAAATGTGGTTTGAAGCTTGCCTTA
CACAAATATTTTTGATTCACTCCTGCTCCATAATGGAATCTGGTTTCTTTCTGGCTATGG
CCTTTGATCACTATGTGGCCATATGCAAACCTCTTAGACATTCAGCAATCCTGACCCACA
CAGTCATTGGGAGCATGGGATTGGCTATTATTTTCCGTAGAGCTGTGCTACTTTGTCCTC
ACCCCTTTCTACTCAGATGGCTTCCCTAATGAAAAACTAATTTCATTTCTTATACCTACT
ATGAGTTTATGGCCTTGATCAAGGTGGCCTGTGCTGAGACTAGAATACAGTGCTTATGGc
agcggttctcaacctcataatttgtagcaatgagaatacataatgcatatcaggtcttta
cattctgaatcataactgtagcaaaagtacagttttgttgtagccaccaaaatatttttt
tttgttttggggtcaccacaacatgaggaactgtattgcggggttacagcattagaaaag
ttgagaacaactgGCTTCTGGCCTAATTGTTGCTTTTATTCCTGGAGGACTAGATTTGTA
CTAATCATCAGTGCCTACATTTTCATTCTCCAT


Conceptual translation

MILSNKTNVHPSTFILIGIPG/EDCSIWISIPFCMVDILPLLGIFALLFIIKTDQSLHE
SMYLFLGMLAVTDLFVCTTAILKLLSLFLFKDWEMWFEACLTQIFLIHSCSIMESGFFLA
MAFDHYVAICKPLRHSAILTHTVIGSMGLAIIFRRAVLLCPHPFLLRWLP**KTNFISYT
YYEFMALIKVACAETRIQCLWQRFSTS*FVAMRIHNAYQVFTF*IITVAKVQFCCSHQNI
FFCFGVTTT*GTVLRGYSIRKVENNWLLA*LLLLFLED*I\LIISAYIFILH