Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR52S12P Olfactory Receptor

Gene Symbol Modo-OR52S12P
Organism Opossum
Family 52
Subfamily S
Pseudo Yes
Location scaffold_16805:0-1,965,080 (-)

Sequence information


Nucleotide sequence

ATCACCATATCAGGTTCTAATTGGACCAATTTAAATCCTTCCACATTTTTTCTTATTGGT
ATCCCAGGCCTGGAAACTGTCTCCATCTAGATCTCCATTCCCTTCTGCTTTATGTACATA
TCAGGTCTTTGGGGAAAGTTCTCTCTTCTCTCCATCATCAATATTGACCCTAGTCTTCAT
GAGCCTGTGTATCTTGCCTACTGTATGGTGGCAACTACTGATCTGATTATTTGTGCCACT
GCCACACCAATAGTTCCTTGGCCTCTTTTGGTTCCAACTCAGAGAAATCATCTCTTTTGA
AGCTTGCCTCACCCAAGTGTTCTTGATCTATTGACCTTCCAACATGGAATCTGGTTTCAT
CTTAGCAATGGCTTTTTATTATTTGCTTATGTGGTCTTATGCAAACCCTTGAGACACTCA
ACTATTTTAGCCCATAAGGTCATTCTGGAGGAATTTGGTTGGCTATTGTCCTTTGAGGAG
CTGTGGTTTTCTACTCTTCATCTCTTTTATTGAAATGGCTTCCATATTGCAGGACCAACA
TCAGTTTTCACACATATTATGATTTCATGGTCTTGATTAAATTGGCCTGTGCTCCAACTA
AACTCTGCAGAGCTTATAGTCTAATGGTTGCCTTTATCACTAGGGGATGGGAGAGTCTGG
ACGTCATATTGATAATTTCTTCCTATGTGCTTATTTTAGTGTTAGGTGTTTTTCTGCTTT
CCCTCAACAACTGCCTGGTTAACACACTGGGCACCGATGACTCCCATGTTTGTGCCATCA
TAACTGACTATATTCCATCTTCCTTCTCCTTCCTCACTCAAAGGTTTGGGTACCATGTTG
CTCCTCATGTGCACATTTTTGTGGCTATCATTTACCTTTTGTTCTCACTCATGTTGAAAC
TCATGATCTATGGGTTATTTACAAAGAGAATATGGGAAGGGTTTCTCCAAATTCTGAGAT
GTCCAAAGTTG


Conceptual translation

ITISGSNWTNLNPSTFFLIGIPGLETVSI*ISIPFCFMYISGLWGKFSLLSIINIDPSLH
EPVYLAYCMVATTDLIICATATP\FLGLFWFQLREIISFEACLTQVFLIY*PSNMESGF
ILAMAFYYL/YVVLCKPLRHSTILAHKVILEE/WLAIVL*GAVVFYSSSLLLKWLPYC
RTNISFHTYYDFMVLIKLACAPTKLCRAYSLMVAFITRGWESLDVILIISSYVLILVLGV
FLLSLNNCLVNTLGTDDSHVCAIITDYIPSSFSFLTQRFGYHVAPHVHIFVAIIYLLFSL
MLKLMIYGLFTKRIWEGFLQILRCPKL