Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR55B3P Olfactory Receptor

Gene Symbol Modo-OR55B3P
Organism Opossum
Family 55
Subfamily B
Pseudo Yes
Location scaffold_15168:0-3,161,900 (-)

Sequence information


Nucleotide sequence

ATGGAGGAACATGAGAACACCACAACCTCCAATATCTCCTACACAGACTTCTTCCTGGTG
GGCTTTCCTGGGCTGCGGGAATGGCGTTCCCTCTTGGTTCTTCCCCTTTCCTTCCTCTAT
GCCTTGATTCTGTCTGCCAATGCCTTGGTCATCTGCACTGTGGCCATCCATTGAAGCCTG
CACCAGCCCATGTACATGCTCATTTCTTTGCTCCTGGCTGTCAACATTTGTGCTGCCAGT
GCCGTGGTGCCCCAGATGCTGTCAGGCTTTGTACACTATGCAAACGCCATCTCACTGTAG
GCATGCCTTGTTCAGATGTTCTTCATCTACTTCACCCTTCTCCTAGACTACAACCTCTTG
CTGGCTATGGCTCTGGACCGCTATGTCGCCATCTGCCACCCACTCCGCTATGCAGACCTG
GTGACACCACATTTGTTGGGCTTGCTGGCTGTGGTTGCCCTGATCCGCAGCTTGGCTGTG
GCAGTGCCCCTGGTGGTGCTGACTTCCCGAGCACACTTCTGTAGGACAGCAGTGATCCGC
CATTTTGCCTGTGAGTATATTGCCCTGCTGAGCATTGCATGTGGGGACATAACCTTCAAC
AACCGGCTGGGGTTGGCTATGAGGCTGATCACAGTGACCTTCGATCTGTCCTTGCTGGGG
GCCTCTTACACCCGAATCATATATGTTGCCTTCCAGATTTCCTCAGGCAATGCCCGAGCC
AAGGCTCTCCACACATGTGGCTCTCACCTCTTGGTCATCTTCACCATCTACCTCTCTGGC
CTCTCCACATCGATTGTCTTTCGGTCTTGCTAAGTCTGTGTCTCAGGATGTGCAGAACTT
GCTCAGTGCCATCTACCTGCTTCTCCCAGGAGCCCTAAATCCCATCCTCTAT


Conceptual translation

MEEHENTTTSNISYTDFFLVGFPGLREWRSLLVLPLSFLYALILSANALVICTVAIH*SL
HQPMYMLISLLLAVNICAASAVVPQMLSGFVHYANAISL*ACLVQMFFIYFTLLLDYNLL
LAMALDRYVAICHPLRYADLVTPHLLGLLAVVALIRSLAVAVPLVVLTSRAHFCRTAVIR
HFACEYIALLSIACGDITFNNRLGLAMRLITVTFDLSLLGASYTRIIYVAFQISSGNARA
KALHTCGSHLLVI\PSTSLASPHRLSFGLAKSVSQDVQNLLSAIYLLLPGALNPILY