Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR55B9 Olfactory Receptor

Gene Symbol Modo-OR55B9
Organism Opossum
Family 55
Subfamily B
Pseudo No
Location scaffold_15168:0-3,187,500 (-)

Sequence information


Nucleotide sequence

ATGACAAGGTGGAATGAGACCCACAATATCTCCTACACTGACTTCTTCTTGGTAGGTTTC
CCAGGGCTGCAGGAGACCCGATCCCTCCTGATCCTTCCATTCTCCTGCATATACTTGGTG
ATCCTCTCGGCCAATGCCTTGGTCATCTACACTGTAGTGGCCCAGAGAAGCCTGCACCAG
CCTATGTATGCACTCATTGCTCTGCTACTGACTGTCAATCTTTGTGCTGCTACTGCTGTT
GTGCCTGCCATGCTCTATAGCTTCTCAACCCACTACTATCGCATTTCTCTTTCCTGCTGC
CTCCTCCAGATGTTCTCCATCTACTTCCTCATTGTCTTTGACTGCAACATCCTCCTAGTC
ATGGCTCTAGACCGTTACGTTGCCATCTGCTATCCACTACGCTATCCAGAAATTGTGACA
GGGCAGCTGTTGGCAGGGTTGGTAGGTTTAGCAGCAATGAGGAGCACGTGCATTGTTGCC
CCGGTGGTAATACTGGCCTCAAGAGTCCGCTTCTGCCGCTCCAACATCATCCGTCACTTC
ACCTGTGAGCACATGGCCCTGATGAAGCTGTCCTGTGGGGACATCTCACTCAATAAGACA
GTGGGGCTTGCAGTCCGAGTCTTCAACCGGGTCCTGGACATGTTGCTCTTGGGCACCTCC
TACACACGCATCATCCATGCTGCCTTCCGGATCTCCTCTGGGGGTGCCCGCTCCAAAGCC
CTGAATACTTGTGGCTCCCACCTGCTAGTCATCTTCACTGTCTACTCCTCCACCCTTTCC
TCTTCCATTGTCTATCGCATAGCCCGCACTGCCTCCCAGGATGTACACAACCTGCTCAGT
GCCTTCTATTTACTGCTCCCCTGTCTTGTCAACCCTGTTATCTATGGAGCCAGAACCAAA
GAGATCCGGCAACACCTGGTCAAGATATTCCAGAGAGCAGGACCTCAGGCCACTTCTGAG
AAAAATCCATCCCAA


Conceptual translation

MTRWNETHNISYTDFFLVGFPGLQETRSLLILPFSCIYLVILSANALVIYTVVAQRSLHQ
PMYALIALLLTVNLCAATAVVPAMLYSFSTHYYRISLSCCLLQMFSIYFLIVFDCNILLV
MALDRYVAICYPLRYPEIVTGQLLAGLVGLAAMRSTCIVAPVVILASRVRFCRSNIIRHF
TCEHMALMKLSCGDISLNKTVGLAVRVFNRVLDMLLLGTSYTRIIHAAFRISSGGARSKA
LNTCGSHLLVIFTVYSSTLSSSIVYRIARTASQDVHNLLSAFYLLLPCLVNPVIYGARTK
EIRQHLVKIFQRAGPQATSEKNPSQ