Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5AK11P Olfactory Receptor

Gene Symbol Modo-OR5AK11P
Organism Opossum
Family 5
Subfamily AK
Pseudo Yes
Location scaffold_18549:0-615,733 (+)

Sequence information


Nucleotide sequence

ATGAAAGCCATGATCCATAAACATGGCACCAGAGTGACTGATTTCATTCTACTGGGATTT
CCAGTTCGACAAGAAGTACAGTACATTCTCTTCCTTGTGTTTCTGGTTATCTACATTATT
TCTCTAGTGGATAATGTAGGTATGATTCTGTTCATCAAGGGTGATGCCCATCTTCACACA
CCCATATATTTTTTCCTCCAAAACTTGACTTTGATTGACCTCTGTTACACCTCTGCCATC
ACTCCAAGACATTACTAAACTTCCTGATCTCAGAGAAATCTATCTCATTTGTTGGGTATG
TGATACAATTATATGTTTATGGCATGTTTGCTATGATTGAATTATATCTTCTGGCTGTCA
TGACTATAAATCGTTACATACCCATCTGCAACCCACTCCATTATCCAGAGGGGTTGACTT
CTGCTGTACGCTGAACCTCATATTATAGGTTTGCAGAATGTCACTACCCAAGTAGGCTTG
CTCTTTTCACTATCCTTCTGCAATTCCAACATAATCAATCATTTCTTTTGTGATTTGCCC
CCCAATTCTGGCTCTTTCCTGTTCTAATATTGATGTCAATGTCATGTTATTAATGATTTT
TGTGGGCTTTAACCTGTTAAGCACGTTGTTCCTTGTGTTCTTCTCCTGCGTTTATATCTT
GGCTTCCATCTTGAGGATGCCCTCAGCCTCAGGGAGGCACAAAGCCTTCTCTACTTGTGC
TTCATACCTGACTGCTGTCACCATTTTATATGGGACACTCTCTTACATGTATTTAAAGCT
TTCTTCCAGTGAGACAGAAGAGAATGATAAAGTTGTCTCTGTATTTTATGGTATCATGAT
TCCCATGTTGAACCCCTTGATCTATAGTCTGAGGAACAAGGAGGTAAAAGAGGCTGTGAA
GATTCTCTTAAAAGGTTGTTTG


Conceptual translation

MIHKHGTRVTDFILLGFPVRQEVQYILFLVFLVIYIISLVDNVGMILFIKGDAHLHTPIY
FFLQNLTLIDLCYTSAITPR/LLNFLISEKSISFVGYVIQLYVYGMFAMIELYLLAVMT
INRYIPICNPLHYPEGL\LLYAEPHIIGLQNVTTQVGLLFSLSFCNSNIINHFFCDLPP
\LALSCSNIDVNVMLLMIFVGFNLLSTLFLVFFSCVYILASILRMPSASGRHKAFSTCA
SYLTAVTILYGTLSYMYLKLSSSETEENDKVVSVFYGIMIPMLNPLIYSLRNKEVKEAVK
ILLKGCL