Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5B57P Olfactory Receptor

Gene Symbol Modo-OR5B57P
Organism Opossum
Family 5
Subfamily B
Pseudo Yes
Location scaffold_12795:0-991,934 (-)

Sequence information


Nucleotide sequence

ATGGAGAATGACTCAGAGGTAAATGAGTTTATTCTTGAAGGATTAACAGATGCACCAAAG
CTTCAGGTTCCCCTCTTTATAATGTTCACCATCATCTAACTCATCACCCTAGTGGGGAAT
CTGGGAATGGTAGGTCTTATTTCCTGGGACTCCCATCTCCATACTCCCATGTACTTTTTT
CTCAGTAACCTTTCTCTAGTAGACTTTGGCTACTCCTCAGCTGTGACTCCTAAAGTGATG
GCTGGATTCTTTACAAAGAACAAAGTCATCTCCTACAATGGATGTGCGGCACAGATGTTT
TTCTTCATGGCCTTTGCTTCAGCAGAAAGCTACCTTCTAGCTGTAATGGCTTATGATCGC
CAAGAAGCTGTATGTAAACCACTCCATTACACCACCACCATGACTTCAAGTGTGTGCGCT
ACTCTGGCCATTGGTTCCTATGTCTGTGGATTCTTGCAATCTTGCATCCACACAAGCTGC
ACCTTCAGCCTGTCTTTCTGTGGTTCCAATGTGATTCATCACTTTTTCTGTGACATTCCC
CCCCTCCTGGCTCTCTCCTGCTCTGATATCCATCTTAATGAGCTGGTGGTCTTCTTGTTA
GGGGGGATCACTATCTTTTTTATCCTCTTGGTCATCTTGACTTCCTATCTATTCATTTTC
ATTACGATCATGAGAATACGCTCAGCTGAAGGCCGGCGGAAAGCCTTCTCTACCTGTGCA
TCCCACCTTACAACGTGTTTCCATATTTTTTGGGACAATCATCTTCATGTACTTACAACC
CAGTTCTAGTCATTCCATGGACACGGACAAAATGGCATCTGTTTTCTACACCATGGTCAT
TCCCATGTTGAACCCTCTGGTTTATAGCCTGAGGAATAAAGATGTCAAGAGTGCTTTCAG
GAAAGCAACTTGTTTGCAAAGATTTCAT


Conceptual translation

MENDSEVNEFILEGLTDAPKLQVPLFIMFTII*LITLVGNLGMVGLISWDSHLHTPMYFF
LSNLSLVDFGYSSAVTPKVMAGFFTKNKVISYNGCAAQMFFFMAFASAESYLLAVMAYDR
QEAVCKPLHYTTTMTSSVCATLAIGSYVCGFLQSCIHTSCTFSLSFCGSNVIHHFFCDIP
PLLALSCSDIHLNELVVFLLGGITIFFILLVILTSYLFIFITIMRIRSAEGRRKAFSTCA
SHLT\VSIFFGTIIFMYLQPSSSHSMDTDKMASVFYTMVIPMLNPLVYSLRNKDVKSAF
RKATCLQRFH