Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5B72P Olfactory Receptor

Gene Symbol Modo-OR5B72P
Organism Opossum
Family 5
Subfamily B
Pseudo Yes
Location scaffold_12795:0-1,798,570 (-)

Sequence information


Nucleotide sequence

ATGGAGAACAGCACAGAGGTGAATGAATTCATTCTGGTGGGATTGACAGATGTCCCAGAG
CTTCAAGTGCCCCTCTTCATTGCATTCACATTCATCTATTTTGTCACCCTGGTGGGAAAC
CTAGGGATGATAGCACTGATCTTCTTGGATCCCCAACTCCATACTCCTATGTATTTTTTC
CTCAGTAATCTCTCTCTGGTAGATTGCATTTATTCATCGGCTGTTACTCCCAAAGTGATG
TCTGGGCTTCTCACAGGGAACAAAGTCATCTCCCATGATGGCTGTGCAGCTCAGATGTTC
TTCTTTGTGGCATTTGCTAGTGTGGACTGTTTCCTTCTGGCTGTTATGGCCTATGATCGT
CATGCAGCTATATGTAAGCCTCTCTATTACACCACAACCATGAGACCAAATGTGTGCAAG
TGTCTGGTAATTAGTTGTTATATCTGGGGCTTCACTGAGTCCTCCATCCACACTGGCTTC
ACTTTCTACCTCTTTCTGTGGTTCAAATATAGTCCATCATTTTTTCTGTGATATTCCTCC
AATTTTGGCTCTCTCTTGTTCTGATATTCATATAAATGAAGTGATGCTCTTCATCTTGGC
TTCCTTCAATGTCTTTTTTGCTCTCTTCATAATCTTGACCTCTTACATCTTCATCTTCAT
CACCATCCTGAGGATGCATTCTGCTGAGGGCCAACAGAAAGCCTTTTCTACCTGTGCCTC
CCACCTGACAGCAGTGTCCATATTCTATGGGACTGTAATCTTTATGTACTTACAGCCCAA
CTCTAGTCATTCCATGGATAATGACCAAATGGCCTCCGTGTTTTACACAATAGTAGTCCC
CATGCTGAACCCTCTGGTATATAGTCTGAGGAACAAAGAGGTCAACAGAGCCTTTAGAAA
AGCTGTTGAGAGGGCAAAGCATCTACTATGCATA


Conceptual translation

MENSTEVNEFILVGLTDVPELQVPLFIAFTFIYFVTLVGNLGMIALIFLDPQLHTPMYFF
LSNLSLVDCIYSSAVTPKVMSGLLTGNKVISHDGCAAQMFFFVAFASVDCFLLAVMAYDR
HAAICKPLYYTTTMRPNVCKCLVISCYIWGFTESSIHTGFTFY//FCGSNIVHHFFCD
IPPILALSCSDIHINEVMLFILASFNVFFALFIILTSYIFIFITILRMHSAEGQQKAFST
CASHLTAVSIFYGTVIFMYLQPNSSHSMDNDQMASVFYTIVVPMLNPLVYSLRNKEVNRA
FRKAVERAKHLLCI