Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5B80P Olfactory Receptor

Gene Symbol Modo-OR5B80P
Organism Opossum
Family 5
Subfamily B
Pseudo Yes
Location scaffold_12795:0-1250406 (-)

Sequence information


Nucleotide sequence

ATGGAGAACACATCTGAAGTGAATGAGTTCATCCTTATAGGATTAACAGATGACCCATGG
CTTCAAATTCCTCTTTTCATAATGGTCACCCTCTTCTATCTCATCACCCTAGTTGGGAAC
CTGGGAATAGTAACTTCTGATCTCCTGGGATTCCTGTCTCCATACCCCAATGTACTTTTT
CCTCAGGAAACTATCTCTGGTGGATTTGAGTCTTTCCTCAACTGTTATTCCCAAAGTGAT
GACTGGGCTCCTCACAGGGGATAAGGCCATCTCTTATAATGGATGTGCTACCCAATTGTT
CTTCTTTGGGGCCTTTGCTGCTATTGAAAGTTACATCTTAGCCTTCATGGCCTATGATCG
CCATGCAGCTGTGTGTAGACCCCTACATTACACCACTATCATGACTTCAAAAATGTGTAC
ATATATGACCACTGGGGCTTACATCTGGGGATTTCTGACCTCCTTCATATTCGTAGAAAA
TGTTTTTAGTCTTTCCTTCTGCAGGTCCAATGTTATCCATCATTTTTTCTGTGATAGTCC
CCTCTCTCTTAGTTCTCTCTTGCTCTGAAATTCACACCACTGAGTCAATAATCTTCATAT
TTGGGTCATTAAATGCGTCCTTCCCATTTCTTGTTATCTTTTTCTCTTACTTATTCATCT
TCATCACCATCCTGAAGATCCGTTCTGCTGATGGGCGCCAGAAAGCTTTCTCCACCTGTG
CTTCCCATCTCACAGCAGTGTTCATATTTTATGGGGCCATCATCTTCATGTACTTCCGAG
CCCAGCTCAAGCCATTCAATGGACTCAGACAAAATGGCATCAGTATTCTACACCATGGTT
ATCCCTATGTTGAATCCTCTCATCTATAGTCTGAGAAACAAAGAAGTTAAGAATGCTTTC
AGAAAAGCTGTGAGAGGACAACGCCTT


Conceptual translation

MENTSEVNEFILIGLTDDPWLQIPLFIMVTLFYLITLVGNLGIV\LISWDSCLHTPMYF
FLRKLSLVDLSLSSTVIPKVMTGLLTGDKAISYNGCATQLFFFGAFAAIESYILAFMAYD
RHAAVCRPLHYTTIMTSKMCTYMTTGAYIWGFLTSFIFVENVFSLSFCRSNVIHHFFCDS
P\LLVLSCSEIHTTESIIFIFGSLNASFPFLVIFFSYLFIFITILKIRSADGRQKAFST
CASHLTAVFIFYGAIIFMYFR\SSSHSMDSDKMASVFYTMVIPMLNPLIYSLRNKEVKN
AFRKAVRGQRL