Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5CE1P Olfactory Receptor

Gene Symbol Modo-OR5CE1P
Organism Opossum
Family 5
Subfamily CE
Pseudo Yes
Location scaffold_12795:0-2886509 (+)

Sequence information


Nucleotide sequence

ATGTTCATCTTACTAGGATTCTCAACCAACCTGATCTTCCAGCCATTATAATATTCCTGG
AAATCTATATCATGACTATGACCTGGAATCTAATCTTCATCATTCTCTTCAGGTCTGACA
CCTATCTTCCCTCCTCTAGCATTCACAGATATCTGCTACTCCTCAACTATTAACCCAAGA
ATGCTCTCTGACCCATTTAGTATTCATTTTTGGCTTGGATGAGTCTGACTGAGTGTTGTC
TCTTGGATATCCTGGTATATGACCATTATGTGACCATCTGCAGCCCACTGAGATACACCA
CAGTCATGGATCTCTAACTATAAGAAATTGGTATCTAGGGCTTATATGGGTGGGTTTTTC
AGAAGCTTATTGAAACAACAGCTGGTTTCCTCCTGTATTTCTGTGAGACAAATATAGTCA
TTTTTTCTGTGATGTTGTTTAGATCATAGCCCTGTCCTACTCCACCCTGTTTATCAGTCA
AATAATCTTATTAATTATAGTGGTTCTTATTGGATACTTTACATTCCCTGTTATACAATA
CATCACAGTCACAATCCTGAAAATACCTTCTGCTAAGGGAAAGGTGCAGGCCCTCAATAC
TTGTGCCTCTCACCTGACAGTTGTGATTCTCTTTTGGCAGTGGCACTTTTGTATACCTTC
ATCCCAGTTCTGACTACACCCAACACCCGGACAAGGTGCTATCTTTCTTCAATGTCATCC
TAATCCCTATGCTGATCCACCTGATCTAAAGTCTAATGAACAAGGAGATTAAAGATGTCA
TGAAGAGTTTGGTGAAAAAAATTTATTTTTCCTTA


Conceptual translation

MFILLGFS/QPDLPAIIIFLEIYIMTMTWNLIFIILFRSDTYLPSSSI\DICYSSTIN
PRMLSDPFSIHFWL/MSLTECCLLDILVYDHYVTICSPLRYTTVMDL*L*EIGI*GLYG
WVFQKLIETTAGFLLYFCETNI/HFFCDVV*IIALSYSTLFISQIILLIIVVLIGYFTF
PVIQYITVTILKIPSAKGKVQALNTCASHLTVVI/L/GSGTFVYLHPSSDYTQHPDKV
LSFFNVILIPMLIHLI*SLMNKEIKDVMKSLVKKIYFSL