Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5D32P Olfactory Receptor

Gene Symbol Modo-OR5D32P
Organism Opossum
Family 5
Subfamily D
Pseudo Yes
Location scaffold_19209:0-1,407,480 (-)

Sequence information


Nucleotide sequence

ATGGTGACCAGTGAGAGAAATCACAGTTCTATTGCTACATTTGTTCTCTTAGGTTTCACC
GATTACCCAGACCTTCAGGTGCCCCTGTTCCTAGTATTCCTGGCCATATATTCCATAACT
GTGGTGGGAAAATCTGGGAATGATTGGCATCATTCGCATCAACCCCAAACTTCACACTCC
TATGTACTTTTTCCTCAGCCACTTGTCCTTTGTGGATTTCTGTTACTCCTCCATCATTGC
TCCCAAGATGTTGGTAGATTTACTCATAGAAGACAGAAGCATCTCCTTCTCTGGGTGTTT
GGTACAATTCTTTTTCTTTTGTACCTTTGTGGTGACTGAATCTTTCCTATTAGCAGTGAT
GGCCTATGATCGCTTTGTTGCCATTTGTAATCCTTTGTTGTACACAGTTGCCATGTCCCA
GAGGCTTTGTGCCCTGTTGGTGGCAGGATCCTACACATGGGGTACAATCTGTTCCCTCCT
ACTCACATGTTCTGCCGTCCAATTATCATTTTATGGATCTAACACAATTAATCACTTTTT
CTGTGAATTTTCATCTCTGCTGACTCTCTCTTATTCTGATACATATTTCAACCAGATGCT
GCTCTTCATCTCAGCCACTTTTAATGAAGTGAGCACACTTTTAATCATCCTGGGCCTCTT
ATGTATTCATTTTTGTTACTGTCCTAAAGATGAATTCATCTAGTGGGAGACGTAAAGCCT
TCTCTACATGTGCCTCTCACCTGATGGCCATTACAATCTTTCATGGGACCATCCTCTTCC
TCTATTGTGTCCCCAACTCCAAGAACTCAAGGCACACAGTGAAAGTGGCCTCTGTGTTTT
ATACAGTGGTAATCCCTATGCTCAATCCCCTAATCTATAGCCTGAGGAACAAAGATGTAA
AAGAAACAGCCATGAAGTTAATGGTCATTAAAATTTCTTCTCCA


Conceptual translation

MVTSERNHSSIATFVLLGFTDYPDLQVPLFLVFLAIYSITVVG\LGMIGIIRINPKLHT
PMYFFLSHLSFVDFCYSSIIAPKMLVDLLIEDRSISFSGCLVQFFFFCTFVVTESFLLAV
MAYDRFVAICNPLLYTVAMSQRLCALLVAGSYTWGTICSLLLTCSAVQLSFYGSNTINHF
FCEFSSLLTLSYSDTYFNQMLLFISATFNEVSTLLIIL\SYVFIFVTVLKMNSSSGRRK
AFSTCASHLMAITIFHGTILFLYCVPNSKNSRHTVKVASVFYTVVIPMLNPLIYSLRNKD
VKETAMKLMVIKISSP