Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5F4 Olfactory Receptor

Gene Symbol Modo-OR5F4
Organism Opossum
Family 5
Subfamily F
Pseudo No
Location scaffold_18549:0-2261666 (+)

Sequence information


Nucleotide sequence

ATGTCTCGGGGAAATCATACTACAGTGACTGAATTCATCTTGTTAGGGTTAACAGACTCA
ACTGAACTTCAAATTATACTCTTTGTATTGTTTTTGTTGATTTATACTCTCACAATGATA
GGAAATGCTGGAATGATTATGCTAATCAAAACAGATTCTCAACTCCACACACCTATGTAT
TTTTTTCTGACTAGCTTGTCTTTGACTGATATTGTTTATTCTTCAACCATCACTCCGAAA
ATGTTAACTGACTTATTGTCTGAAAGAAAAATCATCTCCTTTGCTGGATGTTTTCTGCAG
ATGTATGTCTTCATTGCTTTAATAACTACCGAGTGTATTCTCTTTGGATTAATGGCTTAT
GACCGTTATGTGGCGATCTGTAATCCGCTGCTCTATACAGTTATCATGTCAAAGACAGTC
TGCCTGAAGATGGCCACGGGGGCATTTACAGCAGGATTCTTGAACTCAATAATTCACACC
AGTTACATAAGTAGCTTATCCTTCTGTGGTTCCAATGTCATCCATCACTTTTTCTGTGAC
AGTCCCCCAATCCTTAAACTTTCTTGTTCTGATACACAAATGAATGAAATGATCATTTTC
ATTTGTGCTGGGATAAATATGTTAGGAACACTTCTGATCATTCTTACCTCTTATATATAC
ATCCTCTTCTCCATTCTCCGCTTACATTCAGTTGATGGGAGGCGCAAAGCATTCTCAACC
TGTGCTTCTCATCTTACTGCCATTGTTATATTTTATGGAACTGAGATTGTTACCTATTTG
TGTCCAAGTTCAAGCTACTCCCCAACTCAAGGAAAAGTTTTGTCTGTATTCTACACAGTG
GTCATCCCAATGTTAAACCCCTTAATCTACAGTCTAAGGAATGAAGAAGTGAAGAGGGCT
TTAAAGAATGTGATCTTTAGAAAAAGGAGCCTCATAATTATA


Conceptual translation

MSRGNHTTVTEFILLGLTDSTELQIILFVLFLLIYTLTMIGNAGMIMLIKTDSQLHTPMY
FFLTSLSLTDIVYSSTITPKMLTDLLSERKIISFAGCFLQMYVFIALITTECILFGLMAY
DRYVAICNPLLYTVIMSKTVCLKMATGAFTAGFLNSIIHTSYISSLSFCGSNVIHHFFCD
SPPILKLSCSDTQMNEMIIFICAGINMLGTLLIILTSYIYILFSILRLHSVDGRRKAFST
CASHLTAIVIFYGTEIVTYLCPSSSYSPTQGKVLSVFYTVVIPMLNPLIYSLRNEEVKRA
LKNVIFRKRSLIII