Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5G12P Olfactory Receptor

Gene Symbol Modo-OR5G12P
Organism Opossum
Family 5
Subfamily G
Pseudo Yes
Location scaffold_18549:0-721,006 (+)

Sequence information


Nucleotide sequence

ATGGCCAGTGAAAACTACACCAGGGTCACTGAATTTATTTTCCTGGGTTTACAGTATTAT
CCCCAGATGCAGGTCATCCTGTTTGTGCTTTTTCTGTTCTTCTATCTCTTCACCATGACA
GGAAACCTGGGAATGATCATCTTGATTCAAATTGATGGGGGTCTTCACAGCCCCATGTAT
TTTTTTCCTCAGTCATCTATCATTTGTGTACATCAGCTTCTCTTCTGTGGTGGACCCAAA
GATGTTGAGAGACTTCTTTGAGGAGAGAAAAACTATCTCGTTTCTTGGTTGTGCTTTGCA
GCAATGGTTCTTTGGGTTTTTTGTGGCCATTGAGTGCTTCCTCTTGGCATCCATGGCCTA
TGATCATTATGTTGCAATTTGTAACCCCCTACTTTACTCTGTGGCCATGTCCCAGAGACT
TTGCATCCAGCTGGTGGTTGGTCCCTACACTGTCGGATTCATGAACACCATGACACACAC
CACAGCTACGTTCCGTCTTCCCTTCTGTGGCCCTAATGCCATCAATCACTTCTTCTGTGA
CATATCACCCCTTCTCTCCCTCGTATGTGCTGATACCAGCCTTAATAAGTTGTTAGTTTT
CGTCGTGGCTGGAGCTGTTGGAGTATTTAGTGGCCTGACCATCCTTGTTTCCTACATCTA
TATTCTGACAGCCATCCTCAGGATCTGATCTGCAGAAGGCAGATGGAAAGCATTCTCTAC
CTGTTCTTCTCACCTTACTGCTGTCGCCATCTTGTACGGGACTCTCTTTTTCTGGTGCAA
TTTTATCCCTGGATCTTAACAAAGTTGTCTCTGTGTTTTATACTGCAGTGATCCCCATGT
TGAATCCCCTCATCTATAGCTTGAGGAACAAGGAGGTCAAAGATGCTATCTGCAGGACCA
TTGCTAAAAGGAAGTTTTGTATCAGCAAA


Conceptual translation

MASENYTRVTEFIFLGLQYYPQMQVILFVLFLFFYLFTMTGNLGMIILIQIDGGLHSPMY
FF\SHLSFVYISFSSVVDPKMLRDFFEERKTISFLGCALQQWFFGFFVAIECFLLASMA
YDHYVAICNPLLYSVAMSQRLCIQLVVGPYTVGFMNTMTHTTATFRLPFCGPNAINHFFC
DISPLLSLVCADTSLNKLLVFVVAGAVGVFSGLTILVSYIYILTAILRI*SAEGRWKAFS
TCSSHLTAVAILYGTLFFWCNF\LDLNKVVSVFYTAVIPMLNPLIYSLRNKEVKDAICR
TIAKRKFCISK