Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR5Y1P Olfactory Receptor

Gene Symbol Modo-OR5Y1P
Organism Opossum
Family 5
Subfamily Y
Pseudo Yes
Location scaffold_12795:0-1,826,580 (-)

Sequence information


Nucleotide sequence

AAAATCATCTCCTTCAGCAGATGTGCTACACAGTTTTTCTTTATATTTTTTTGTGGATAT
TTATCTCTTTATTGCTATAGCCTATGATCACCAGGCATCTGTGTGTACATTCCATCATTA
CACCATGATATCCAGTAGATATGATCATCTGGCTATTGGTTCCTAAATCTATGTTTTTCT
TTTTTTCTCTATTCAGACAGCAAATATTTTCAGTTTCCATTTCCGTAGATCACTTTTTTC
CGGGATATTTCACCCTTCTTGTTCTGACATATGCTTTAGTGATTAAGTTGTCTTCTTTGT
TGTAGGATTTGATGTCATTTTTATCATTTTTACCATATTGAAATCCTACATCTTTATTGC
CATTACCATTCTAAGGATGTGTTTAGCTGAGGTCTACTTTTTCCACTTGTGCTTTCCACC
TCACAGTGCTGTCTATATTCTTTGGAACAGTAGTATTTCTTTACTTAAAACCTAACTCTA
GTCATTCCATGGACACAGACAAAATGGCATCAGTGTTCTGCACTGTGGTCATCCCAATGT
TGAATCCTCTGGTCAGGAATTCAGCAATGTATTCAGGAAACTGCTTAAGGGGGAAAAGTC
TTTCTTGG


Conceptual translation

KIISFSRCATQFF/YIFLWIFISLLL/AYDHQASVC\SIITP*YPVDMIIWLLVPKS
MFFFFSLFRQQIFSVSISVDH/FSGIFHPSCSDICFSD*VVFFVVGFDVIFIIFTILKS
YIFIAITILR\V*LRSTFSTCAFHLTVLSIFFGTVVFLYLKPNSSHSMDTDKMASVFCT
VVIPMLNPLVRNSAMYSGNCLRGKSLSW