Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR6AJ1P Olfactory Receptor

Gene Symbol Modo-OR6AJ1P
Organism Opossum
Family 6
Subfamily AJ
Pseudo Yes
Location scaffold_11989:0-72681 (-)

Sequence information


Nucleotide sequence

ATGCATTTGGGTAATTACACAACAATCAAGGGATTTGCACTCCTGGGATTGGGAAACCTC
TTGGGGGTACAGTTTTTCTTGTTTGTGTTATTTCTGGGCATCTATTGCTGGGAAACATTC
TCATCCTCACAGTCATGTCCCTTGATCACACTCTCTACACTCCCACATATTTCTTGCTGG
TCAACTTCTTCTTGGAAAAATCTGGTACATGACTTCCATTGCCCCTAACATGCTAAAGAC
CCTTCTTTGTGGACCAGTGGCCATGTCCTCCTTAGGCTGTGCTCTCTAGTTGTATTTCTT
TGGCTCCATGACAGGGATGGAGTGCTTCTTGCTGGCTGCCATATCCTCTGATTGCTACCT
AGCCAAATGGACCCCACTCTACTCCCCAGCCATCATGAATCTCCAAATGTGTATCTGCCT
TGCATGTGTGTCTTGGTTTGGTGGCAGTCACCCCTGTAGCCACTGTAGCCCTGACTTTCC
AGTTGTCCTTCTGTGTACTGGTGAGATCAACCACTTCTTCTGTGACCTGGCCCTTCATGT
AGAGGCTGGCCTGTGATGATCCTCAGACAGCCAAAAAGTCACCTTCCTTCTGGCCCCTTT
CATGATGATGATACTCTTTTTACTCGTTGTCATTTCCTTTGCCCAAATTGTGGCTACCAT
CCTCAATATCTCTTCAGCAGGAGGGAAACAGTGGGCTTTCTCCACCTGTTCCCCCACCTC
AAgtgaagattggatttggctctcccctgattgtaataatCttcctttat


Conceptual translation

MHLGNYTTIKGFALLGLGNLLGVQFFLFVLFLGIY/LGNILILTVMSLDHTLYTPTYFL
LVNFFL/KIWYMTSIAPNMLKTLLCGPVAMSSLGCAL*LYFFGSMTGMECFLLAAISSD
CYLAKWTPLYSPAIMNLQMCICLACVSWFGGSHP\ATVALTFQLSFC/TGEINHFFCD
LALHV\LACDD/SDSQKVTFLLAPFMMMILFLLVVISFAQIVATILNISSAGGKQWAF
STCS/HL/VKIGFGSPLIVIIFLY