Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR6C121P Olfactory Receptor

Gene Symbol Modo-OR6C121P
Organism Opossum
Family 6
Subfamily C
Pseudo Yes
Location scaffold_15221:0-630631 (+)

Sequence information


Nucleotide sequence

ATGCAAAACCATACAAGGATAACAATATTTATAATTCGGGGATTGACGGATGATCCACAG
TTGCAAGTATTTCTTTTTGTCTTCATGTGTCTTACTTACATTCTGTGTATAACTGGGAAC
TTGACCATCATCACCCTCACCTTGGTGGATCCCCACCTTAAAACTCCCATGTATTTTTTC
CTCCGAAATTTTTCCTTCTTAGAATTATTATTCACAACTACCTGTATTCCCAGATATCTA
TATAATATATCAACTGGTGACAATAGTGTGACCTATAATGCATGTATAACACAAATATTT
TTTGTCACTTTCTTGGCCTCGACAGAATTTTTCCTTTTGACTGTCATGTCATATGATCGC
TATGTGGCCATCTGCAAACCTCTGCATTACACAACCATCATGAGCAGCAAAGTCTATAAC
TTCCTCCTCCTGAGTTGTTGGGTGAGTGGGCTGATAGTTGTCCTCCCACCACTTAGTATC
TGTCTTCAACTGGAATTCTGTGACTCCAATGTCATTGATCATTTTGGCTGTGATCCATCA
CCACTCCTGAAGATCTCGTGCTCTGATACAAGTTTCTTAGATAGAATGATTTTAAATCTT
TGCTGCAGTGTTACTAATCATCACCTTAGTGTTAGTGGTTCTATCTTATGGACACATTAT
CCACACTATTCTGAGATTCCCCTCTGTCCAGCAAAGGAAGAAGGCCTTTTCCACTTGTTC
CTCTCATATGATTGTTGTCTCCATGACTTATGGCACCTGCATCTTCATCTACATCAAGCC
TCCTGGAGAGGAACATCTTGCTTTGAACAAGATTGTGTCAGTACTTGTGACCTCAGTTGC
CCCTGTGATGAACCCTTTTATTTATGCCCTCAGGAATAAGCAAGTAATACAAGCCTTTAA
AAACTTAGTCAAAAGAATCACACATATCTCAAAGATA


Conceptual translation

MQNHTRITIFIIRGLTDDPQLQVFLFVFMCLTYILCITGNLTIITLTLVDPHLKTPMYFF
LRNFSFLELLFTTTCIPRYLYNISTGDNSVTYNACITQIFFVTFLASTEFFLLTVMSYDR
YVAICKPLHYTTIMSSKVYNFLLLSCWVSGLIVVLPPLSICLQLEFCDSNVIDHFGCDPS
PLLKISCSDTSFLDRMILNL\AVLLIITLVLVVLSYGHIIHTILRFPSVQQRKKAFSTC
SSHMIVVSMTYGTCIFIYIKPPGEEHLALNKIVSVLVTSVAPVMNPFIYALRNKQVIQAF
KNLVKRITHISKI