Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR6J3P Olfactory Receptor

Gene Symbol Modo-OR6J3P
Organism Opossum
Family 6
Subfamily J
Pseudo Yes
Location scaffold_19262:0-3138231 (-)

Sequence information


Nucleotide sequence

AAAGAGAATCAGACCACCACAGTGACTGAGTTCATTCTGTTTGGTTTTCCTATCAGCAGA
AAGGTGGAGCAGTCTGTTCTTCATGCTCTTCCTGCCCACATACTTGCAGACACTTCTGAG
GAACATCCTCATCATCTGTACTGTTGTGTCTTTTTCACACCTCTACACATCCATGTACTT
CTTCTGTTATCTTGGACATCTTCTTCACCTCTCTCATTTCCCCAAGGGTACTGACTAATT
TGGCCAGTGGGGATAAGACTATCCCTTGTACTGAATGTATCACC


Conceptual translation

KENQTTTVTEFILFGFPISRKVE\LFFMLFLPTYLQTLLRNILIICTVVSFSHLYTSMY
FFC\LDIFFTSLISPRVLTNLASGDKTIPCTECIT