Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR6V3P Olfactory Receptor

Gene Symbol Modo-OR6V3P
Organism Opossum
Family 6
Subfamily V
Pseudo Yes
Location scaffold_12761:0-195737 (+)

Sequence information


Nucleotide sequence

ATGGGAAATCTGAGCCATCTATATGAATTGATCCTACTGGGATTCTCAACATTTGGCAAG
CTACAGGTCCTGCTTTATGGGCCCTTTCTGGTGCTTTATCTTCTGGCTCTTTTTAGGAAA
TATTCTCATCATTACATGGTCCTAGCCGATGCCTACTTACACACTCCCATATACTTTTTC
CTGGGACATTTTGCTCTATTATCCATCTTGGTGACCAGGACTACAGTGCCCAAGATGCTT
TTAGACCTCCTTGTCTCCACTAAGACAATTCCCTTTACCTTCTGCATGGTCCAATTCTAT
TTCTAATTCTCCTTTGGCTCTACCACCTCCCTCATCCTGGCAGACATGGCTCTGGATCAT
TTTGTGGCTATCTGCCACCCACTACACTACAGCACTCTTATGAATTGTACAGTGTGTTTC
TCTCTCAGGAACAGCCTGGGAAGTACCCTTTCTGGCCATGGTGCCCATTGTTCTTTCCAT
GGTACAGCTCTCCTATTGCCATGACAATATCATTAACCACTTCTTCTGTGACAATGCCCC
CCTGCTACAGCTAGCCTGCTCAGATACATTCCTCCTAGAATTCTGGGACTTCATATTGTC
ATTGGCTTTTGTCCTCAGCTCCTTCCTGGTCACCCTTGTGTTCTAGTCACATTGTGACAC
GTGTTGAGTATTCCTTCTGCAAGTGGCTGCCAAAAGGCTTACTTGTAGTTCTCACCTCAC
TCTGGTATTCGTTGGCTTTGGCAGCATAATCTTTGTCTACATTCAACCTGGCAAGACTCA
CTATGGAGTTAAACAAATTTCTTGTCTTAGTCACTAATATTCTGACTCCTGTCCTCAATT
CCTTTGCCCTAACTTTCCGTAATGAGACTGTCAAGGCTGTTCTTAGG


Conceptual translation

MGNLSHLYELILLGFSTFGKLQVLLYGPFLVLYLLAL\GNILII/MVLADAYLHTPIY
FFLGHFALLSILVTRTTVPKMLLDLLVSTKTIPFTFCMVQFYF*FSFGSTTSLILADMAL
DHFVAICHPLHYSTLMN\QCVSLSGTAWEVPFLAMVPIVLSMVQLSYCHDNIINHFFCD
NAPLLQLACSDTFLLEFWDFILSLAFVLSSFLVTLVF*SHCDTC*VFLLQVAAKRLTCSS
HLTLVFVGFGSIIFVYIQPGKTHYGVKQISC//VTNILTPVLNSFALTFRNETVKAVL
R