Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR6W1 Olfactory Receptor

Gene Symbol Modo-OR6W1
Organism Opossum
Family 6
Subfamily W
Pseudo No
Location scaffold_12761:0-256071 (-)

Sequence information


Nucleotide sequence

ATGATGAACAATCACACCGTGGTCAGGGACTTCGTTCTCTGGGGTTTCTCTCATCTCCAG
GAGTTCCAGATCCTTCTGTTCCTATTTTTCCTTTTGGTGTATGTGCTGATCATACTGGGG
AACTCGTTTGTCATCACAATCACATTCCTTGATTCTCGTCTCCACTCACCAATGTATTTT
TTCCTCTGTAACTTTTCCCTCATGGAGATGCTTGTTACCTCCACTGTTGTGCCCAGGCTG
TTGGCTGATCTGTTCTCCACACACAAAACCATCTCCCTGACTGAATGCCTGATCCAGTCA
TTCTTCTACTTTTCCCTGGGCTCCACTGATTTCCTCATTCTCACTGCAATGGCCTTTGAC
CGTTATGTTGCAATCTGCCGTCCTCTGCACTACCCAACCATCATGAGTGGTCAGGTTTGT
GTCAAGATGGTGATTGCATGCTGGGTGGTTGGCTTCTTCTCCATCATTTCCCCCACCATC
CAAAAATCCCGGCTCTGGTTCTGTGGCCCTAATGTCATTGACCACTTCTTTTGTGATTCT
GCCCCACTATTAAAGCTTTCCTGCTCAGAAACCCACCATATTGAACGCATGGATTTCTTC
CTCTCTCTCCTTTTTGTATTAACCACCATGCTGCTAATCATGATATCCTACATCTTTATT
GTGGCTTCAGTGCTGCGTATTCCTTCTTCCTCTGGCCGTCAAAAGGCCTTTTCCACCTGT
GCCTCACACCTCACAGTGGTGGTGCTTGGATATGGCAGTGCCATTTTCATTTATGTGAGA
CCCAGCAAGGGCCATTCCACAGACCTCAACAAAGTAGTGGCATTAATGACAGCTTTGGTG
ACCCCCTTCCTCAACCCTTTCATCTTCACCTTTCGGAATGAGAAGGTCAAAGAGGTCATT
GAAGACATTGTCAAAAAGATACTTTCCAAAGACTCGGAAGGCTTnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnTCTTTCAG
ACTACCTTTAACTTTTTTCTTCTTTTGTACTCTTTTTTAACTATGGGATTCATTAATCAT
TTAGAATCACTAAGCATCAAGTGCCTCATCAACATGAAAAAGCCAGAAGATGCTTGCTTC
TCTGGGACTGTAGAATATATAATGGAATTTCATCACTTTATAAAGATTTTCTTCTTTCAA
TCTGTTTTCTGGGTTTTTATTTGCATCCACTTATATTTCTTTGAAATGTCTTACATCTTT
TCCAGATATGCTCCATCTTTTGTATTTTATTTCAGTGTCTACGACAGAGATTGGCACCTG
GAAAGTGGTCACAACAATATAGAGACTAGAAAGGGACATACAAAGAGAGTGGTACAACAG
AGAGGTGCGAGCAACCCA


Conceptual translation

MMNNHTVVRDFVLWGFSHLQEFQILLFLFFLLVYVLIILGNSFVITITFLDSRLHSPMYF
FLCNFSLMEMLVTSTVVPRLLADLFSTHKTISLTECLIQSFFYFSLGSTDFLILTAMAFD
RYVAICRPLHYPTIMSGQVCVKMVIACWVVGFFSIISPTIQKSRLWFCGPNVIDHFFCDS
APLLKLSCSETHHIERMDFFLSLLFVLTTMLLIMISYIFIVASVLRIPSSSGRQKAFSTC
ASHLTVVVLGYGSAIFIYVRPSKGHSTDLNKVVALMTALVTPFLNPFIFTFRNEKVKEVI
EDIVKKILSKDSEGFR