Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR7A33P Olfactory Receptor

Gene Symbol Modo-OR7A33P
Organism Opossum
Family 7
Subfamily A
Pseudo Yes
Location scaffold_11688:0-77211 (+)

Sequence information


Nucleotide sequence

ATGGTACCAGGAAACCAAACACAATTCATTGAATTTCTTCTCCTGGGATTTTCAAGGGCA
CCAGAGCAGCAGAGGTATCTCTTTGGCCTGTTCTTGAGCATGTACTTGGCTGCCATTTTG
GGAAACCTGCTCTTAATGCCAACCAATACCTCTGACTCTCACCTTGATACACCCATGTAC
TTCTTTGTCTCCCATCTGTCCTTTGTGGATCTCTGTATTGTAACCACTACCGTCCCAAAG
ACGCTGGTGAACATCTTAACACAAAGCAAGATTATATCTTATGCTGGGTTGTCTTCTCCA
TTTGTGCTTCTTTATGTCTTTAAACTTGTGTGGACAGTTTCCTCCTCCTTGCAATGGTCT
ATGACTATTTTGTGGCTATCTGTCACCCTCTGCACTATACAATCATCATGAGGTTTCTAC
TCTGTGTCCTCTTGGTGCTCCTCTCCCTGGATAATAGGACTTGTAGAGTCCCTAATTCAG
AATCTGATGGTAACAAGGCTCTTCTGTTGAGATCGTGAAATTCAGCACTTATTTTGTGAG
TTTCCTTAAATTATGAAACTCTCTTGCTCTGACATCTTCATAAATTATATGACATTATAT
ATTGTTACTGCAATACTGGGCATTGTTCCATTCACAGGGATTATTTTTTCATGCAGTAAG
ATCTGTTCTTCCATTGTGAAAATTCCAACTGCTATGGGTAAGTACAAAGCCTTTTCTACC
TGTGGATCTCCATCTCTGTTGTTTCTTTATTCTATGGCACAGGGCTGGGAGTGTATTTCA
GCTCTTCCACTACTCACTATTCCTGGAAAAGCACAATTGCTTCAGCAATATATGCTGTGG
TCACACCCATATTGAACCCCTACATTTATAGCCTTAGAAATAATGACATAAAAGATGCCC
TTAGGAGGCTCATTGTCAGAGTAACTAACTGGAGT


Conceptual translation

MVPGNQTQFIEFLLLGFSRAPEQQRYLFGLFLSMYLAAILGNLLLMPTNTSDSHLDTPMY
FFVSHLSFVDLCIVTTTVPKTLVNILTQSKIISYAG\LLHLCFF\L*TCVDSFLLLAM
VYDYFVAICHPLHYTIIMRFLLCVLLVLLS\IIGLVESLIQNLMVTRLFC*DREIQHLF
CEFP*IMKLSCSDIFINYMTLYIVTAILGIVPFTGIIFSCSKICSSIVKIPTAMGKYKAF
STCGS/ISVVSLFYGTGLGVYFSSSTTHYSWKSTIASAIYAVVTPILNPYIYSLRNNDI
KDALRRLIVRVTNWS