Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR7D20P Olfactory Receptor

Gene Symbol Modo-OR7D20P
Organism Opossum
Family 7
Subfamily D
Pseudo Yes
Location scaffold_11688:0-109947 (-)

Sequence information


Nucleotide sequence

ATGGCACCAGGAAACCAAACAAAATTCATTGAATTTATCCTCCTGGGATTTTCTGAGACA
CCAGAGCAACAAGGGACCATCTTTGGGCTGTTCTTGGGCATGTACTTGGTCACTGTATTT
GGAAACATACTCATAATGTTGGCTGTTGGCTTTGATTCTCACCTCCACACCCCCATGTAC
TTCTTCCTTTCTAACCTGTCCTTTGTAGATCTTTGTGTGGTATCTACCACGGTACCCAAG
ATGTTAGTGGGCATCTTGACACAAAACAAGGCCCATCTCCTATGCTGGCTGCCTTGCCCA
GATGTACTTCTTTATAGTTTTTGTTGGTTTGGACAATTTCCTTCTCACTGCAATGGCCTA
TGACCGTTTTGTGGCTATCTGTCACCCTCTGCGCTATACATACATCATGAGTCCTGAGTT
GTGCTGCCTGATGGTGCTGCTCTCCTGGATACTAAGTCTTCTCAACACCCTCCTTCACAG
TCTGATGGTGACAAGGCTCTCCTTCTGTACAGGCCATGAAATCCAGCACTTCTTTTGTGA
TCTTGATCAAGTTCTAAAACTCTCATGTTCTGACACTCTTATCAATTATGTCTTGCTATA
TATTTTAGCTGGTCTGCTTGGTATTCTCCCCCTCACAGGGATTCTCTTCTCATATAGTCA
GATCTTTTCTTCCATTTTGAAAGTCCCATCTGCTGGGGGTAAGTACAAAAGCATTTTCTA
CCTGTGGATCTCATCTCTCTGTTGTTTCCTTATTCTATGGCACAGCGATGGGAGTGTATT
TCAGCTCCTCAGTGACCCAGTCTTCCTGGAAGAGTACAGTTGCCTCAGCAATGTATGCTG
TGGTCACCCCCATGCTGAACCCCTTCATCTATTGTCTTAGGAACAAAGATATAAAAGGTG
CCCTGTGGAGACTCATTAGCAGAATATGCTCCTCTCAG


Conceptual translation

MAPGNQTKFIEFILLGFSETPEQQGTIFGLFLGMYLVTVFGNILIMLAVGFDSHLHTPMY
FFLSNLSFVDLCVVSTTVPKMLVGILTQNKA\SYAGCLAQMYFFIVFVGLDNFLLTAMA
YDRFVAICHPLRYTYIMSPELCCLMVLLSWILSLLNTLLHSLMVTRLSFCTGHEIQHFFC
DLDQVLKLSCSDTLINYVLLYILAGLLGILPLTGILFSYSQIFSSILKVPSAGGKYK\F
STCGSHLSVVSLFYGTAMGVYFSSSVTQSSWKSTVASAMYAVVTPMLNPFIYCLRNKDIK
GALWRLISRICSSQ