Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8AA3P Olfactory Receptor

Gene Symbol Modo-OR8AA3P
Organism Opossum
Family 8
Subfamily AA
Pseudo Yes
Location scaffold_18549:0-1,276,990 (+)

Sequence information


Nucleotide sequence

CACTTCATTACATATTTATTTGGTGGGGTCTTCCTACTCTCAGGCATGGCTTATGACTGC
TATGTGGCCATCTGCAATCCCCACTCCTTTACACTTTTCATGTCTTAACAAGTTTCTATT
TTAAAACAGTGTTTGCAAGCATTTACTCTTGTGGCTTCTTTTTTTGGAATCCTATAGATC
ATTGTTACTTTCCAGTTGTCCTTTTGTGCTTCTAATGATTTCTACTGTGATGATGTTCCT
CTGGTTGCTTTGGCCAATTCTGACATATATTCAAAAGCTACTGATAGTTCTTTTTGCTGT
ATCAACACACTTCTTTCTCTGTTGATTGTACTTATCTCTTATCTATTCAGCCTTCTTGTC
ATCTTTAAGAATCATTTCTGAAAAAGGGATACAGAGGGCTTTTTCAACTTATGTTTTTCA
AATGGTCTCCCTCATTATGTTTTATTGGACAGTGATCTTCACTTATCTAAAACCAAAATC
AGACCATTTTTGGAGACTGATAAGGTAGCCTCTGTTTTCTATTCAGTAGTGCTCCCCATA
TTGAATTCCCTCATCTAGAGTCTTAGAAACAAAGAGGGTGAAAAGTGCCCCATGGAATAT
TTGAAAGAAAATGTATTCCAGGATAAAA


Conceptual translation

HFITYLFGGVFLLSGMAYDCYVAICNPHSFTLFMS*QVSILKQCLQAFTLVASFFGIL*I
IVTFQLSFCASNDFYCDDVPLVALANSDIYSKATDSSFCCINTLLSLLIVLISYLFSLLV
I\RIISEKGIQRAFSTYVFQMVSLIMFYWTVIFTYLKPKSDH/LETDKVASVFYSVVL
PILNSLI*SLRNKE\KSAPWNI*KKMYSRIK