Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8D10P Olfactory Receptor

Gene Symbol Modo-OR8D10P
Organism Opossum
Family 8
Subfamily D
Pseudo Yes
Location scaffold_18579:0-7260761 (-)

Sequence information


Nucleotide sequence

ATGAGAAAATGGAATCAGTCTGAAATAAATGAATTTTATTCTTTCAGGACTAACATATGA
GCCAGAGCTTCAACTGCCTCTTTTCTTCATGTTCTTGGTCATCTATATGGTCACTGTGGT
GGGTAATGTGGGTATGATCATGCTGACTAGAATTAGTTCTCAACTCCACACTACCAAGCA
TTATTTCTTCAGCAGCTTGTAGCTTGTCCTTTTTAGATGTCTGTAATTCTTCTGTTCTTT
TTTTTTTCTCCCTAAATGCTACTGGGATTCTTATTCAAAGATAAAATAATCCCTTATCCT
AGGTACATGACTCAACTCCATTTCTTCTGCATTTTTGTAATTTCTGAGTGCTACATGCTG
GCAGCCATGGCTTATGACCACTATATTGCCTTCTGTAGCCCCCTATTGTACAACATCATC
TTATTTACACAGGTCTGCTCCTTGGCCTTTGTGTTTTCTGTTGGCCTTATTGATGCA


Conceptual translation

MRKWNQSEIN\FILSGLTYEPELQLPLFFMFLVIYMVTVVGNVGMIMLTRISSQLHTTK
HYFFSSL\LSFLDVCNSSVLFF\P*MLLGFLFKDKIIPYPRYMTQLHFFCIFVISECY
MLAAMAYDHYIAFCSPLLYNIILFTQVCSLAFVFSVGLIDA