Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Opossum symbols

Opossum Modo-OR8D4 Olfactory Receptor

Gene Symbol Modo-OR8D4
Organism Opossum
Family 8
Subfamily D
Pseudo No
Location scaffold_18579:0-7234249 (-)

Sequence information


Nucleotide sequence

ATGGGAAGAGGAAATCAGTCTGAAGTGACTGAATTTATTCTTGCAGGACTAACAGATGAG
CCAGAGCTTCAGCTGCCCTTTTTCTTCATGTTCTTGGTCATCTATATGGTCACTGTGGTG
GGGAACATGGGCATGATCATCTTAATTGGAATTAGTTCTCACCTCCATACTCCCATGTAC
TATTTCCTCAGCAGCTTGTCTGTTTTAGATGTCTGTTATTCCTCTGTTGTTACCCCTCAA
ATGTTAGTAGGATTCTTATTCGAAGATAAAACAATCTCCTATCCTAGGTGCATGACTCAA
CTCTTTTTCTTCTGTATTTTTGTAATTTCTGAGTGCTACATGCTGGCAGCTATGGCTTAT
GACCGCTATGTTGCCATCTGTAGCCCCCTACTGTACAATACAATCATGTCCCCACAGGTC
TGCTCCTTGCTGGTGGTCTTTGTGTTTTCTGTAGGTCTTATTGATGCAGTGATACATACA
GGTTGTATATTGAGGTTGCCATTTTGTGGGTCAAATATAATCAGTCATTACTTCTGTGAC
ATTGTGCCCCTCATCAAACTCTCCTGTGCCAGCACTTATCTAGATGAGCTCCTGATTTTT
GTTATTGGTGGATTCAACATGATAGCAACCAGCTTGACAATTATAATCTCTTATGCTTTC
ATCCTCTCCAGTATCCTGCGCATCAACTCCAAAGAGGGCAGGTCCAAAGCCTTTAGTACT
TGTAGTTCCCATATCATGGCAGTTACCGTGTTTTATGGGTCTCTTATGTCCATGTATCTC
AAACCGGCTTCCAGTAGCAACCTGGCCCAGGAAAAGGTGTCCTCAGTATTTTATACCACA
GTGATTCCAATGCTGAATCCCCTGATCTACAGCCTGAGAAACAAGGATGTGAAGAATGCA
TTAAAGAAACTCATCCAAAAGAAAATATCCTCA


Conceptual translation

MGRGNQSEVTEFILAGLTDEPELQLPFFFMFLVIYMVTVVGNMGMIILIGISSHLHTPMY
YFLSSLSVLDVCYSSVVTPQMLVGFLFEDKTISYPRCMTQLFFFCIFVISECYMLAAMAY
DRYVAICSPLLYNTIMSPQVCSLLVVFVFSVGLIDAVIHTGCILRLPFCGSNIISHYFCD
IVPLIKLSCASTYLDELLIFVIGGFNMIATSLTIIISYAFILSSILRINSKEGRSKAFST
CSSHIMAVTVFYGSLMSMYLKPASSSNLAQEKVSSVFYTTVIPMLNPLIYSLRNKDVKNA
LKKLIQKKISS